KEGG   Glycine soja (wild soybean): 114382130
Entry
114382130         CDS       T06057                                 

Definition
(RefSeq) phenolic glucoside malonyltransferase 1-like
  KO
K13264  isoflavone 7-O-glucoside-6''-O-malonyltransferase [EC:2.3.1.115]
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj00943  Isoflavonoid biosynthesis
gsj00944  Flavone and flavonol biosynthesis
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00944 Flavone and flavonol biosynthesis
    114382130
   00943 Isoflavonoid biosynthesis
    114382130
Enzymes [BR:gsj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.115  isoflavone-7-O-beta-glucoside 6''-O-malonyltransferase
     114382130
SSDB
Motif
Pfam: Transferase
Other DBs
NCBI-GeneID: 114382130
NCBI-ProteinID: XP_028197168
Position
13
AA seq 467 aa
MAETPTLRIHEVCPISPPQETPSTTIPFTFFDVLWLRLPPVERLFFYSFPNPTTTSSFFD
TTILPNLKHSLSLTLHHFPPLAGTITWPLHTPLPLITYTPGNSIPFRIAESNADFNTLSS
NLSEVNNHRRNLIPHLPTSHEEASVLALQLTHFPNQGYSIGITSHHAALDGKSSTLFMKS
WAHICSYLNTSPEEPLLFSLPKHLTPSFDRSVIRDPLGIGEIYAKSWTSFGGATNDRSLN
VWDTLGGNQTDLVKGLFELTPLDIKKLKKLAESKFVVGDNKKKVRVTSFTVTCAYLLSCA
VKAEQPNCERVPFVFNVDCRARLDPPIPETYFGNCVVALLASAKREELLGEEAFFKSVIG
ISEELNGLEGDVLNGADKWIPKIQSVVSETPRLFSVAGSPRFEVYGIDFGWGRPEKVDVT
SVDKTGAFSLSESRDHSGGIQIGLALTKNQMEAFSRVFAQGLESLES
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggcagagacaccaaccctcagaatccacgaagtctgccccatctcgccgccacaagaa
accccatcaaccactattcccttcaccttcttcgacgtcctatggctacgcctcccccca
gtggagcgtctgttcttctattccttcccaaacccaacaacaacctcttcattcttcgac
accaccattctcccaaatctcaaacactccctctccctcactctccaccacttccctcct
ctcgccggcaccatcacatggccacttcacacacccctccccctcatcacctacaccccc
ggaaactcaatccccttcagaatcgccgaatccaacgcagacttcaacaccctctcttca
aacctctcagaagttaacaaccaccgccgaaacctaataccccacttacccacttcccac
gaagaagcttcggtgttagcccttcaactcacccacttcccaaaccaaggctattcgata
ggaataacaagccaccacgcagcacttgatggaaagtcttcaactttgttcatgaaatcg
tgggcgcatatttgttcttacctcaatacctcaccggaagaaccgttgctgttttcacta
ccgaagcatctaacaccttcgtttgatagatctgtcataagagaccctttggggatcggt
gagatttacgcgaagtcgtggacgagcttcggtggagccaccaatgaccgaagcttgaac
gtgtgggataccctcggtggaaatcaaaccgatttggttaaaggattgtttgagttgaca
ccgttggatatcaagaagctgaagaagttagcggagtccaagtttgttgtcggagacaac
aagaagaaagttagggtgacatcatttacggtcacgtgcgcttacctgttgtcatgcgcg
gtgaaagcggagcaacccaactgcgaaagagtgccttttgtcttcaacgtggactgtagg
gcgcgtttggaccccccaattccggaaacgtacttcgggaactgcgtcgtggctttgttg
gcttcggccaagcgagaagagcttttgggggaagaagcgtttttcaaaagcgttataggg
ataagcgaggagttgaacgggttagagggtgacgtgttgaacggcgcggacaaatggatt
ccgaagattcaatcggtggtatcggagactcctaggttgttctccgtcgccgggtccccg
aggtttgaggtttacggcattgactttgggtggggaaggcctgagaaagtggatgtcaca
tccgttgataaaacgggtgcgttttcgctctcggagagtagggatcatagtggagggatt
caaattgggttggcgttgaccaagaatcaaatggaggcgttttctagggtttttgctcaa
ggacttgagtccttggaatcatga

DBGET integrated database retrieval system