KEGG   Glycine soja (wild soybean): 114387047Help
Entry
114387047         CDS       T06057                                 

Definition
(RefSeq) pterin-4-alpha-carbinolamine dehydratase 2, mitochondrial-like isoform X1
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj00790  Folate biosynthesis
gsj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    114387047
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gsj04147]
    114387047
Enzymes [BR:gsj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     114387047
Exosome [BR:gsj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   114387047
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 114387047
NCBI-ProteinID: XP_028202947
Position
15
AA seq 180 aa AA seqDB search
MNRLLLVRHPLLALSKLPPLSPFSQTYYYSYTPTRINSQIYKIKDPPRTSAAFCTTNKEL
SSKKCVPCNTKDLQPMTEDAAGTLLSQIAQWNLVNEGGVLKLRRSWKVKTFTKGLEFFRI
IADLADAEGHHPDLHLVGWNNVTIEICTHSVGGLTQNDFILAAKINELNLHDLLRRKASD
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgccttcttcttgttcgtcaccctctactagctttatccaagctaccaccacta
tcacccttttcccaaacctattattattcatacacacccacacggataaattctcaaata
tataagattaaggaccctcctcgcacaagcgctgcattttgcactaccaacaaagagttg
tcatctaagaagtgtgtaccgtgcaatacaaaggacttgcaacccatgactgaggatgca
gcaggcactctgctttcccagattgcccagtggaatttggtaaacgagggtggtgtgttg
aaattgaggagatcatggaaagtaaagacttttaccaaaggattggaatttttcaggata
atagctgatcttgctgatgcggaaggtcatcatcctgatcttcaccttgttggctggaat
aatgttactatagagatttgtacacattctgtaggtgggctgacgcagaatgacttcatt
ctagctgctaagatcaatgagcttaatttgcatgacttgctaagacggaaggcttctgac
tga

DBGET integrated database retrieval system