KEGG   Glycine soja (wild soybean): 114387079Help
Entry
114387079         CDS       T06057                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase LECRK3 isoform X1
Organism
gsj  Glycine soja (wild soybean)
SSDB OrthologParalogGFIT
Motif
Pfam: Thaumatin Pkinase Pkinase_Tyr B_lectin APH PIP49_C Pox_ser-thr_kin
Motif
Other DBs
NCBI-GeneID: 114387079
NCBI-ProteinID: XP_028202998
Position
15
AA seq 918 aa AA seqDB search
MVQPTWLFSLLILTLQLSASGVNSTKFTLVNQCNYTVWPALSGDDYLSTTGFVLRSGESS
TVTPPAKWKGLIWGRTLCTNSSATGNFSCVTGDCGSGKIACYGRTASMPPVTRLEFSLSD
TNFPDIYDVSLAVGFNVPAIIVPISSSSKCNSTGCAVDMNRVCPTELKTIKNGQVVGCQN
PNPCIGDASSNCEPSVYSKIFKTSCPQAFSYPKDDRTSTFICYDPVDYNIVFCPTSSNTN
TSQSVGDSLMAGNGTSRWLSPSGDFAFGFYQLPNEFFLLAVWYDKMPNKTIIWFANGDNP
APIGSRLELNDSGLVLNNPQGLELWRSNFVSGTIFNGLMNDDGNFQLLDQNSVSLWETFT
HPTDTLVPNQVMELNGKLFSRRGEFNFSHGRFKLHLQEDGNLVLSLNLPSNYSYEPYYDT
GTADANSQTNIDMKLIFDKSGFLYILKKSGEKFYITKPNETISTNDFYYKATINYDGVFT
VSYYPKDLRKGQGWVTTKTIPENICLSSTFTDGEGVCGFNSICNLKADQRPICNCPERYS
LIDSNNMYGGCIPKLTSFPNPNGKKDHDVLIVMLSVLLAGSVLIILMLVGALYFGFSCNR
KKIESSRTNKSVAKKNLHDFTFKELVEATNNFREELGRGSFSIVYKGTIEMTSVAVKKLD
KLFQDNDREFQTEVNVIGQTHHRNLVRLLGYCNEGQHRILVYEFMSNGTLASFLFSSLKS
NWGQRFDIALGIARGLVYLHEECCTQIIHCDIKPQNILLDDQYNARISDFGLAKLLLINQ
SRTETGIRGTKGYVAPDWFRSAPITAKVDTYSFGVLLLEIICCRKNVEKELVNEEKGILT
DWAYDCYKTRRLEILLENDDEAINDIKSFEKLVMIAIWCIQEHPSLRPTMKKVLLMLEGN
VEVLTPPSPYLHGSISEN
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggttcagccaacatggttattttcacttttgatactaacgcttcaattatcagcatca
ggggtcaattccacgaagttcactttggttaaccaatgcaactacacggtgtggccagcg
ttaagcggagatgattatctttcaacgactggcttcgttttgagaagtggcgaatcttcc
actgtgactccacctgcaaaatggaaaggcctgatctggggccgcactctctgcaccaat
agttcagccacgggaaatttctcttgtgtcaccggtgattgcggttccggaaagatagca
tgttacggaagaacagcttctatgccgccggtcacgcgtctagagttttccttaagcgac
accaattttcctgacatttatgatgtgagcctagctgtcggattcaatgtgccggcgata
attgttcccataagcagcagcagcaagtgtaacagcacggggtgtgcggtcgatatgaat
agagtgtgtccgacggagctaaagacaataaaaaatggacaagtggtggggtgtcagaac
cccaacccctgtattggtgatgcgagttccaactgcgaaccaagcgtgtactcgaaaata
ttcaagacttcatgcccgcaagccttcagctacccaaaagacgaccgaaccagcacgttc
atctgttacgatcctgtcgattacaacattgtcttttgtcctacatctagcaacaccaac
accagccaaagtgttggggactcactcatggctggaaatgggacatctcggtggctttct
ccttcaggtgattttgcatttgggttttaccaacttcctaatgagtttttcttgttggct
gtttggtatgacaagatgccaaataagaccattatttggtttgcaaatggagacaaccct
gctcctataggatcaaggttagaactaaatgactctggactagtgctcaataacccccaa
ggtttagagctatggagatcaaattttgtatcaggtacaatttttaatggtctaatgaac
gatgatggaaattttcaactcttagaccaaaattctgtgtcactatgggagactttcacc
catccaactgacacgttagtacctaatcaagtaatggagttaaatggaaaacttttttca
cgacgaggagagtttaacttctctcatggaagattcaaacttcatttacaagaggatgga
aatcttgtgctcagcctcaatttgcctagcaactacagttatgagccttactatgatact
ggcactgctgatgctaatagccaaacaaatattgacatgaaattgatatttgacaaatca
ggcttcttatacatactgaaaaaaagtggggagaagttttatattaccaagccaaatgag
acgatctcaactaatgacttctactacaaagcaacgatcaattatgatggagtttttacc
gtatcatattaccccaaagatctaagaaaaggacaaggatgggtcactacaaagactata
ccagaaaatatttgtttgagttctacattcacagatggtgaaggtgtttgtgggtttaat
agcatatgcaatctcaaagctgaccaaaggccaatatgtaactgcccagagagatattct
ttaattgattcaaataacatgtatggtggttgcataccaaagctgacctctttcccaaac
ccaaatgggaagaaagatcatgatgtcttgatcgttatgttatcagttcttttggccggc
tctgtgttaatcattttgatgttggttggtgcattatattttggtttctcgtgcaaccgc
aagaagatcgaaagtagtagaaccaacaaaagtgttgctaaaaagaatttgcatgacttt
accttcaaggaacttgtggaagcaacaaacaactttagagaagaattgggaagaggatct
tttagcattgtatacaaaggaacaatagagatgactagtgtggcggttaaaaaattagac
aagttgttccaagataatgacagggaatttcaaactgaggtgaatgtaataggccaaact
catcataggaacctagttcgtctacttggatattgcaacgaaggacaacatcgaattctg
gtatacgagtttatgagcaatggcactttagcaagcttccttttctcttctttgaaatcc
aattggggccaacgatttgacattgcccttgggattgccagaggtcttgtttacttgcat
gaggaatgttgcacccaaatcatccattgcgacataaagccacaaaatatacttttggat
gatcaatataatgctagaatttcagattttgggttagcaaagctgttattgatcaatcaa
agccgcactgaaactggaattagaggaacaaaagggtatgttgcaccagattggtttaga
agtgcaccaatcactgctaaggttgacacttatagttttggtgtgttgttactagagatc
atttgttgtagaaagaatgtagaaaaggagcttgttaatgaagaaaaagggatattgact
gattgggcatatgattgctacaagactagaagactagaaattcttttagaaaatgatgac
gaagctattaatgacataaagagctttgaaaaacttgtgatgattgctatttggtgcatt
caagaacatccttctcttaggccaacaatgaagaaggttttgctgatgctagaaggaaat
gttgaagttttaacacccccaagtccctaccttcatggttctattagtgaaaattga

DBGET integrated database retrieval system