KEGG   Glycine soja (wild soybean): 114387393Help
Entry
114387393         CDS       T06057                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300
Organism
gsj  Glycine soja (wild soybean)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase ABC1 APH DUF3487 DUF5408 YukC
Motif
Other DBs
NCBI-GeneID: 114387393
NCBI-ProteinID: XP_028203376
Position
15
AA seq 408 aa AA seqDB search
MSPVTLIIVGFAGILFVIFCILVWLQPNCKSIPAGILTPDSKFMSLTMDKFLNEMERMKP
IRFTNQHLRIATDNFTYLLGSGGFGAVYKGVFSDGTIVAVKVLHGNSDKIIEEQFMAEVG
TVGNVHHFNLVRLYGFCFGRNMRALVYEYMGNGSLDKYLFDENRTIEFEKLHEIAIGTAK
GLAYLHEECQQRIIHYDIKPGNILLDRNLNPKVADFGLAKVCNRKNTHITLTRGRGTPGY
AAPELWMPNFPITHKCDVYSFGMLVFEILGRRRNLDIDHAESQEWFPVWVWKRFEAEEAK
ELIVACGIEDQNREIAERMVKVALLCVQYRQESRPIMSVVVKMLEGSIEIPKPLNPFQHM
IDGTVPLPASQTNTDTSAGSVSSVMVTESSLQSAPPIVTKLEIESAST
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccgtaactctcataatcgtgggctttgcaggtatcttatttgtgatattttgt
attttggtatggctccagcccaactgcaaatcaatacctgctggaatacttactccagac
tcaaagtttatgtcacttactatggataaatttctgaacgagatggaaaggatgaagcct
atccgatttacaaatcagcatctaagaattgcaactgataacttcacttacttgttgggg
tcaggaggttttggagcagtctataagggagtttttagcgacggaacaattgtagctgtg
aaggttctacatgggaattctgacaagataattgaggagcagtttatggcagaagtgggg
acagttggcaatgttcaccatttcaatctggttcggctctatggattttgctttggcaga
aacatgagagctctggtttatgagtacatggggaatggctctcttgacaagtatctgttt
gatgaaaataggaccatagaatttgaaaagcttcatgagattgcaattgggacagccaaa
ggccttgcttacttgcatgaagaatgccaacaaagaataatccactatgacatcaaacca
ggaaatattctcttggacaggaacctcaatcctaaagtagctgattttggtttagccaaa
gtttgcaacaggaaaaatactcatataaccctgactaggggtaggggaactcctggttat
gctgcccctgagctttggatgccaaattttcctataactcataaatgtgatgtttatagc
tttggcatgctagtatttgaaatcctaggcaggagaagaaaccttgacatagaccatgct
gaaagccaggaatggtttcctgtatgggtttggaaaagatttgaggctgaagaagcaaag
gaattaattgtagcgtgtgggatagaggatcaaaacagagagattgctgaaagaatggtt
aaggttgctctattatgtgttcagtataggcaagaatcaagacctataatgagtgttgtg
gtgaaaatgttggagggttcaattgaaattccaaaacctctaaacccatttcagcacatg
attgatgggactgttccactcccagcatcacagaccaacactgatacaagtgctggttca
gtttcttctgtgatggtaactgaatccagccttcaatctgctcctcctattgtgacgaag
ctcgagattgaatcagcttctacctaa

DBGET integrated database retrieval system