KEGG   Glycine soja (wild soybean): 114387639Help
Entry
114387639         CDS       T06057                                 

Definition
(RefSeq) shikimate O-hydroxycinnamoyltransferase-like
  KO
K13065  shikimate O-hydroxycinnamoyltransferase [EC:2.3.1.133]
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj00940  Phenylpropanoid biosynthesis
gsj00941  Flavonoid biosynthesis
gsj00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
gsj01100  Metabolic pathways
gsj01110  Biosynthesis of secondary metabolites
Module
gsj_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    114387639
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    114387639
   00941 Flavonoid biosynthesis
    114387639
Enzymes [BR:gsj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.133  shikimate O-hydroxycinnamoyltransferase
     114387639
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transferase
Motif
Other DBs
NCBI-GeneID: 114387639
NCBI-ProteinID: XP_028203648
Position
15
AA seq 289 aa AA seqDB search
MQHHVADGASGLHFINAWSDVARGLDISLPPFIDRTLLRARDPPHPVFDHIEYKPPPAMK
TPLQQQLQSSKPVGSDSAVAVSTVKLTRDQLSTLKGKSREDGNRISYSSYEMLAGHVWRS
VCKARALPDDQETKLYIATDGRARLQPPLTPGYFGNVIFTTTPIAVAGDLMSKPTWFAAS
RIHDALIRMDNEYLRSALDYLELQPDLKVLVRGAHTFRCPNLGITSWARLPIHDADFGWG
RPIFMGPGGIAYEGLSFIIPSSTNDGSMSVAIALPPEQMKVFQELFYDI
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaccatgtagcagacggagcatctggtcttcactttatcaatgcatggtcagat
gttgcccgtggcttggatatttccctccccccattcattgacaggacactactccgtgcc
cgggatccacctcatcctgtttttgatcacattgaatacaagcccccaccagccatgaag
actcccctgcagcagcaactgcaatcctcaaaaccagtaggctctgacagtgctgtggcc
gtctctactgtcaaattgacccgtgaccaactgagcaccctcaagggtaagtccagagaa
gatggcaacagaatcagctacagctcttatgagatgttggctggtcatgtatggagaagt
gtgtgcaaggcaagagcacttcctgatgaccaagaaaccaaattgtacattgcaactgat
ggacgggcaaggctgcaacctcccctcacccctggttactttggcaatgtcatcttcacc
accactcctatagcagtggctggtgatctcatgtcaaaaccaacatggtttgctgctagc
agaatccatgacgcattaatacgaatggacaacgaatatttgagatcggctcttgactat
ctagagctgcagcctgatctaaaagttcttgttcgtggagcacatacctttaggtgtcca
aatcttggtatcactagctgggcaaggcttccaatccatgatgctgactttggttgggga
agacccattttcatgggacctggtgggattgcatacgagggactatctttcataattcca
agctcaacaaatgatgggagcatgtctgtggcaatcgctctgccccctgagcaaatgaaa
gtgtttcaggaattgttttatgatatttga

DBGET integrated database retrieval system