KEGG   Glycine soja (wild soybean): 114388616Help
Entry
114388616         CDS       T06057                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PBL9 isoform X1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
gsj  Glycine soja (wild soybean)
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gsj01001]
    114388616
Enzymes [BR:gsj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114388616
Protein kinases [BR:gsj01001]
 Serine/threonine kinases: TKL group
  IRAK family
   114388616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Pkinase_fungal Kinase-like HRCT1
Motif
Other DBs
NCBI-GeneID: 114388616
NCBI-ProteinID: XP_028204991
Position
15
AA seq 422 aa AA seqDB search
MGVCLSAQIKAESPYNTGFNSKYVSTDGNDFGSTNDKVSANSIPQTPRSEVEILRSSNLK
SFTLSELKTATRNFRPDSVLGEGGFGSVFKGWIDENSLTATKPGTGIVIAVKRLNQDGIQ
GHREWLAEVNYLGQLSHPHLVRLIGFCLEDEHRLLVYEFMPRGSLENHLFRRGSYFQPLS
WSLRLKVALDAAKGLAFLHSAEAKVIYRDFKTSNILLDSKYNAKLSDFGLAKDGPTGDQS
HVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGKRAVDKNRPSGQHNLVEW
AKPYLANKRKIFRVLDTRLEGQYSTDDACKLATLALRCLSIESKFRPNMDEVVTTLEQLQ
VPNVNGGHQNGSRVRRRSADVNRGYQNPSVNGSRVRRRSADDISPMETPTAYPRPSASPL
YT
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgggagtttgtttgagcgcccaaattaaagctgaaagcccatataacactgggttcaat
tcaaagtatgtgagtacggatggaaatgatttcggcagcacaaacgataaggtttcagca
aactcaattcctcaaactcctcggagtgaggttgagatcttgcggtcatccaatttgaag
agctttaccttgtcagaacttaagacggccactagaaatttccgtccagatagcgtgtta
ggagaaggtggttttggatcagtttttaaggggtggatcgatgagaattcattgactgct
accaaacctggcactggcattgttattgctgttaaaagacttaatcaagatggcatccag
ggtcacagggagtggttggctgaagtcaactatcttggacagctttctcatcctcatcta
gtgagattgattgggttttgccttgaagatgaacatcgccttctcgtctacgaatttatg
ccacgtggaagcttggaaaaccatttgttcaggagaggctcatattttcaaccactttct
tggagcctacgtttgaaggtagctcttgatgctgccaaagggcttgcatttctccacagt
gcagaagcaaaagtgatatatagagattttaagacttcaaatatcttgctggattcaaaa
tataatgcaaaactttctgattttgggctggcaaaggatggaccaacaggtgaccaaagt
catgtctccaccagggtaatgggaacctacggatacgcagcacctgaatatctagccaca
ggtcatcttactgctaagagcgatgtctatagttttggggttgtcctgctggaaatgttg
tctggcaagagggctgttgacaagaatagaccatctggacaacacaatttggtggaatgg
gctaaaccttacctggcaaacaagcgtaagatatttcgtgtgttggacacccggctcgaa
ggacaatattcaacagatgatgcctgtaagctagccacccttgccttgcggtgcctatca
atagaatccaagttcaggccaaacatggatgaagtggttacaacattggagcagctgcaa
gttcctaatgtaaatggaggccatcaaaatgggtctcgtgttcgtagaagaagtgctgat
gtgaatagaggctatcaaaatccttctgttaatggatctcgagttcgtagaagaagtgcc
gatgatattagccctatggagactcccacagcttatccccggccttctgcatcccctctc
tatacttga

DBGET integrated database retrieval system