KEGG   Glycine soja (wild soybean): 114390826Help
Entry
114390826         CDS       T06057                                 

Definition
(RefSeq) calmodulin-binding receptor-like cytoplasmic kinase 2
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
gsj  Glycine soja (wild soybean)
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gsj01001]
    114390826
Enzymes [BR:gsj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114390826
Protein kinases [BR:gsj01001]
 Serine/threonine kinases: TKL group
  IRAK family
   114390826
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal ABC1 APH
Motif
Other DBs
NCBI-GeneID: 114390826
NCBI-ProteinID: XP_028207518
Position
16
AA seq 438 aa AA seqDB search
MTSPYTPRRRSSSDHRTRPERAPPSPGYASSEFSTSSTVSAHRNSVSAVAKSFAGIFAGC
FSPPDSDNSKSLGDSEEFKSSSTVSNASRAGSQRGHGSKRGTSISSYNILPAKEPGSVEF
TMEEIFRVTRNFSPSFKIGQGGFGAVYRAKLLDGTVVAVKRAKKSVYEKHLGVEFQSEIQ
TLSRVEHLNLVKFFGYLEQEDERIIVVEYVPNGTLREHLDCIHGSVLDLAARLDIAIDVS
HAITYLHMYIDHPIIHRDIKSSNILLTENFRAKVADFGFARQAPDSDSGMTHVSTQVKGT
AGYLDPEYLKTYQLTEKSDVYSFGVLLVELVTGRRPIEPKFELRERITARWAMKRFIEGD
AISVLDPRLDQIAANTLALEKILELALQCLAPRRQSRPTMKRCAEILWSIRKDIREQLSA
SNFRSFSTSSQRSTSLKE
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacatctccttatactcctcgccggcgatccagctccgaccaccgcaccaggccagaa
agagcgcccccctcccccggttacgcctcctccgagttcagcacctcctccaccgtctcc
gcccaccggaactccgtctccgccgtcgccaagtccttcgccggaatctttgccgggtgc
ttctccccgccggattccgacaactccaagagcctcggggattccgaggagttcaagtct
tcttccactgtatcaaatgcttccagagctggtagtcagagagggcatggctcgaaacga
ggtaccagcatcagttcatacaacatattaccagcgaaagaaccaggcagtgttgagttc
accatggaggaaatcttccgagtcacaagaaacttctccccttctttcaagattggccaa
ggtggttttggtgctgtctatagggccaaactcctggatgggactgttgttgcagtaaag
cgtgctaagaagagtgtgtatgagaaacatttgggggtggagttccagagcgagatccaa
acactatcacgtgtggaacatttgaacttggtcaagttctttggatatttggagcaagag
gatgaaaggatcattgttgtggagtatgttccaaatggaacccttagagagcatttagat
tgcattcatggaagcgttctggaccttgctgcacgtttagatatagcaattgatgtttct
catgctattacctatcttcatatgtatatagatcatcctatcattcacagagacataaaa
tcttcgaacattcttctcactgaaaattttcgagctaaggtagcagactttggttttgct
agacaagcccctgacagtgactctggcatgacacatgtttccacccaagtaaaaggaaca
gctggttacttggaccctgaatacctgaaaacttatcaactaactgaaaagagtgacgtg
tattcatttggagttttgcttgttgaacttgtcacaggaagacgccccattgaaccaaaa
tttgaactcagggagcgaatcacggcaagatgggctatgaagaggttcattgagggagat
gctatctcagtcttggacccaagactggaccagattgctgcaaatactttagcactagaa
aagatccttgagctagctttacagtgcttggctccacgtagacaaagtaggccaactatg
aagagatgtgctgagatcctttggtccatccgcaaggatatcagagagcagctatccgct
tcaaatttccgctcattttccacttcttcccaaagaagcacctcattgaaagagtga

DBGET integrated database retrieval system