KEGG   Glycine soja (wild soybean): 114390872Help
Entry
114390872         CDS       T06057                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK10 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
gsj  Glycine soja (wild soybean)
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gsj01001]
    114390872
   01009 Protein phosphatases and associated proteins [BR:gsj01009]
    114390872
Enzymes [BR:gsj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114390872
Protein kinases [BR:gsj01001]
 Serine/threonine kinases: Other
  Wnk family
   114390872
Protein phosphatases and associated proteins [BR:gsj01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     114390872
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C
Motif
Other DBs
NCBI-GeneID: 114390872
NCBI-ProteinID: XP_028207584
Position
16
AA seq 674 aa AA seqDB search
MNSGAVLALPPVSNVFRTREPHDFEDDFVEKDPTGRYIRYNEILGRGAFKTVYRGFDEVD
GIEVAWNQVKIDGLMHSVDDLAKLYSEVNLLKSLKHENIIKFYDSWIDDKQKTVNMITEL
FTSGNLRLYRKKHKYVEMKAIKGWARQILHGLVYLHSHRPPIIHRDLKCDNIFVNGNQGE
VKIGDLGLAVVMQQPTAQSVIGTPEFMAPELYEEAYTELVDIYSFGMCILEMVTLEYPYS
ECKNPAQIFKKVTSGIKPASLNKVSDPQLKEFIEKCLVPASERLSAEELLKDPFLQVENP
KDPILYPLQPPSRTLRAYSFKSGSLSMDMDSDCKPFSMSICSESNQENPHCPVFEVQRTN
NKHEFRLKGTKNDDNSVSLTLRIADTCAGRVRNIHFLFYLDTDTAVSVATEMVEHLELAD
HDVDFIAELIDYLIMKLLPWWKPSPDHFSCGELSPYSTNIDGQWPWGSVLTSIPSELAID
QDGFSGSDTTPKEDFVASEKSSVSKNDSNATFEGDCNSSSLVKLEDRYSQGSRASEMIVE
NTSMKNDNCHDSNADVSSESLSNSMSELEIGGAYFEDCKLQPAEYCSGEGVVINEFPKNS
GSVLGTSINVENPTNSCSYVSSTEEDIIDLELQFKLDEIEAHYQHWIDELKKMMLEALDS
TRRSWVAKKKLAVQ
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgaattctggtgctgtcttggcattgcctccagtaagcaatgtattcaggacaagggaa
cctcatgattttgaggatgactttgtggagaaagatccaactggccggtacataaggtac
aatgaaatcttgggtagaggtgccttcaaaaccgtttataggggttttgatgaagttgat
ggaatagaagttgcttggaaccaagttaagattgatggcctcatgcattcagtagatgat
cttgcgaaattgtattctgaagttaatctattgaagtctttgaaacatgaaaatatcatt
aagttctatgattcttggattgatgataagcagaaaactgttaacatgattactgaactc
ttcacatcaggaaatttaaggctatatcgtaagaagcataaatatgttgaaatgaaagct
ataaaaggttgggccaggcagatccttcatggcttagtatatcttcacagtcacaggcca
cccattattcacagagacttgaaatgtgacaacatctttgtgaatggaaaccaaggtgaa
gttaagataggggaccttggtttagcagttgtcatgcaacaaccaactgcccaaagtgtt
attgggactcctgagtttatggctccagaactatatgaagaggcatacactgaacttgtt
gacatctattcttttgggatgtgcatattggagatggttactcttgaatatccctatagt
gaatgcaaaaatcctgctcaaatctttaagaaagttacctcaggcatcaaacctgcttcc
cttaataaggtgagtgatccccaacttaaggagtttattgagaaatgtttggttccagca
tctgagagattgtcagcagaggagcttcttaaagacccatttctacaagttgagaatcca
aaggatcccatcctttatcctttacaaccgcctagccgaacactgagagcatattcattc
aagtctggttctctatctatggacatggattctgactgcaaaccgttttctatgagtatc
tgttctgaaagcaaccaggaaaacccacattgtcctgtttttgaagtgcagcggacaaat
aataaacacgagtttaggttgaaagggactaaaaatgatgataactcggtatcattgacc
ttgcgtattgctgatacatgtgcaggtcgagtccggaatatacattttctcttttacctt
gatacagatactgcagtctctgtggccacagagatggttgaacatttggagctggcagat
catgatgtagatttcatagctgagcttattgattacttgataatgaaacttctaccttgg
tggaagccctcacctgatcatttctcatgtggagaattaagtccttatagtacaaatata
gatggccaatggccatggggttctgtcctaactagtattccctctgaattggctattgat
caggatggcttctctgggtctgatacaactcccaaagaagattttgttgcatctgagaag
agcagcgtttccaaaaatgatagcaatgctacttttgagggtgattgtaattcttctagt
ctggttaaattggaagatcgatattcacaaggatctagagcttctgagatgattgttgaa
aacacttctatgaaaaatgacaattgtcatgattccaatgctgatgtaagttctgaaagc
ttaagtaattccatgtctgaacttgagattgggggtgcatattttgaggactgtaaattg
caaccagcagaatattgttctggagaaggagttgtgataaatgaattcccaaagaactca
gggtcagttcttggaacgtccattaatgttgagaaccctacaaatagttgttcttatgtg
tcatcaacagaagaggacattattgatcttgagctacagtttaaacttgatgaaattgag
gcacactatcagcattggattgatgaacttaagaaaatgatgttggaggcattggattcc
accagaaggagttgggtggccaagaagaaattggctgttcagtga

DBGET integrated database retrieval system