KEGG   Glycine soja (wild soybean): 114393435Help
Entry
114393435         CDS       T06057                                 

Definition
(RefSeq) autophagy-related protein 16-like
  KO
K17890  autophagy-related protein 16-1
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    114393435
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gsj04131]
    114393435
   03029 Mitochondrial biogenesis [BR:gsj03029]
    114393435
Membrane trafficking [BR:gsj04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    114393435
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    114393435
Mitochondrial biogenesis [BR:gsj03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    114393435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 PQQ_2 Nup160 Cytochrom_D1 DUF2935 zf-C4H2 V_ATPase_I
Motif
Other DBs
NCBI-GeneID: 114393435
NCBI-ProteinID: XP_028210591
Position
17
AA seq 514 aa AA seqDB search
MAKARKSQEEIASEAIKHALKALRKRHLLEEAAHAPTVLALSRPIVSQGSEWKEKAENLQ
MELQQCYKAQSRLSEQLVVEVAESRASKTSLQEKENALADLQKELTELRDECSQLKVDLE
EKIKSLELVVSENSELKAQLEQMTTKANKAEAENKMLIDRWMLEKMKDAERLNEANTLYE
EMVEKLRASGLEQLARQQVDGIVRRSEEGAEFFFDSNIPSTCKYRLRAHEGGCASMLFEY
NSSKLITGGQDRLVKMWDANTGSLSSTLHGCLGSVLDLTITHDNQSVIAASSSNNLYVWD
VNSGRVRHTLTGHTDKVCAVDVSKISSRHVVSAAYDRTIKVWDLVKGYCTNTVIFRSNCN
SLSFSMDGQTIFSGHVDGNLRLWDIQTGKLLSEVAAHSLAVTSLSLSRNGNVVLTSGRDN
LHNLFDVRSLEVCGTLKAMGNRVASNWSRSCISPDDNHVAAGSADGSVYIWSISKGDIVS
TLKEHTSSVLCCRWSGIAKPLASADKNGIVCVWT
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagcacgcaagtcgcaagaagaaattgcgagtgaagccatcaagcatgctttg
aaggctctgcggaagcgccatttgcttgaggaagctgctcatgctcccactgttctagct
ctttctagacccatcgtttctcagggctctgagtggaaagagaaagcagagaatcttcaa
atggaacttcagcaatgctacaaagctcaatctcgcctgtctgagcaacttgttgtggaa
gtagctgagtccagagcttcgaaaacgtctcttcaagagaaagaaaatgcattggctgat
ctgcagaaggagttgactgaattgagggatgagtgctctcaattgaaggtggacttggaa
gaaaaaattaaatctctggaactggttgtcagtgagaattctgaacttaaagcacaactg
gagcagatgactactaaagccaataaagctgaagctgaaaacaagatgttgattgaccgc
tggatgttagaaaagatgaaggatgctgaacgcctaaatgaggccaacacactgtatgaa
gagatggttgagaaactaagggccagtggtttagaacaacttgcaaggcagcaggtggat
ggtatagttcgccgaagtgaagaaggtgctgaattcttttttgattcaaacatcccttcc
acatgtaaatacaggcttcgtgcacatgaaggtggttgtgcttccatgttgtttgagtac
aattccagtaaattgattactgggggacaggatcggttagttaaaatgtgggatgcaaat
acaggatccttaagttctactcttcatggctgccttggctcagtattggatctcacaatc
acccacgataatcaatctgtcattgctgcaagcagctcaaacaacttgtatgtatgggat
gtcaactcaggtcgtgtccgtcatacccttactggccacactgataaagtttgtgctgtt
gatgtcagcaagatttcaagtcgtcatgttgtcagtgctgcctatgatcgtaccataaaa
gtttgggacttagtgaaaggttactgcacaaacacagtaatttttcgcagcaactgcaat
tctctttccttcagcatggatggtcaaaccatattttctgggcatgttgatggtaacctt
cggctatgggacattcaaactggaaagttacttagtgaggttgctgcccattcacttgca
gtcacgtcactatccctttcccgaaatggaaatgttgtactgaccagtggaagggacaat
ttacacaatttgtttgatgtgcgatctctggaagtttgtggcacattaaaagccatggga
aacagagtggcttctaattggagtcgctcctgtatcagcccagatgacaatcatgttgct
gctgggtctgctgatggatctgtctatatttggtcaatatctaaaggtgatatagtcagt
actctgaaggaacacacttcctctgttctgtgttgtaggtggagcggaattgcaaaaccc
ctagcttcagctgataagaatgggattgtttgcgtctggacataa

DBGET integrated database retrieval system