KEGG   Glycine soja (wild soybean): 114395197Help
Entry
114395197         CDS       T06057                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP20-1-like
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
gsj  Glycine soja (wild soybean)
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    114395197
Enzymes [BR:gsj01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     114395197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C DUF5401
Motif
Other DBs
NCBI-GeneID: 114395197
NCBI-ProteinID: XP_028212713
Position
18
AA seq 188 aa AA seqDB search
MGDAIDLTGDGGVIKTIVRKSKADAVGPTENFPLVDVHYEGTLADTGEVFDTTHEDNTIF
SFEIGKGSVIKAWEIAVKTMKVGEVAKITCKPEYAYGSAGSPPDIPPDATLVFEVELVAC
RPRKGSSLGSVSEERARLDELKKQRELAAAAKEEEKKKREEAKAAAAARVQAKLEAKKGQ
GKGKGKAK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatgcaattgatttgactggtgacggaggagtcattaaaaccattgtaagaaaa
agcaaagctgatgctgtcggtccaacagaaaatttccctcttgttgatgttcattatgaa
ggcacacttgctgatactggtgaagtttttgacactacacatgaagataacaccatcttc
tctttcgagattggaaagggcagtgttatcaaggcttgggaaattgcagtgaaaaccatg
aaggttggagaagttgcaaaaataacttgcaagccagaatatgcatatggtagtgcagga
tctcctccagatattcctccagatgcaacacttgtttttgaagttgagctagttgcctgt
cggccaaggaagggctccagtttgggaagtgtttcagaggagagggctaggcttgatgaa
ctgaagaagcagagagagctagctgctgctgccaaagaggaggagaaaaagaagagagaa
gaagcaaaagcagcggctgccgcacgtgtgcaagccaagttagaagccaaaaaaggtcaa
ggaaagggtaaaggtaaagcaaagtag

DBGET integrated database retrieval system