KEGG   Glycine soja (wild soybean): 114395736Help
Entry
114395736         CDS       T06057                                 

Definition
(RefSeq) MDIS1-interacting receptor like kinase 2-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
gsj  Glycine soja (wild soybean)
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gsj01001]
    114395736
Enzymes [BR:gsj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114395736
Protein kinases [BR:gsj01001]
 Serine/threonine kinases: TKL group
  IRAK family
   114395736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LRR_8 LRR_4 LRR_1 LRR_6 Pkinase_fungal TAS2R ABC1 PIP49_C
Motif
Other DBs
NCBI-GeneID: 114395736
NCBI-ProteinID: XP_028213380
Position
18
AA seq 681 aa AA seqDB search
MKFLVICSVVIMGITLELEAVPTPSQLQLEENAIINSGWWNRSKSVASRNICSWYGMSCN
VAGSITRINYPFYTPGIRLATLNLSAFKNLEWLEVSNCGLQGTIPSDIGDLPKLTHLDLS
HNSLHGEIPPSLANLTQLKSLIISHNKFQGPIPGKLLFLKNLTGLNLSYNSLDGEIPPVL
ANLTQLENLDLSNNKFQGPIPGELLFLKDLNWLDLSYNSLDDEIPPALVNLTELERLDLS
NNKFQGPIPAELGHLLLSVQNVNVNLSFNNLKGPIPYGLSEIQLIGNKDVCSHDSYYIDK
YQFKRCSAQDNKVRLNQQLVIVLPILIFLIMLFLLLVCLRHTRIATKNKHANTTAATKNG
DLFCIWNYDGNIAYEDIIRATQDFDMRYCIGTGAYGSVYRAQLPSGKIVAVKKLHGFEAE
VAAFDESFINEVKVLSEIKHRHIVKLHGFCLHRRIMFLIYEYMERGSLFSVLFDDVEAME
LDWKKRVSIVKGTAHALSYLHHDFTPPIVHRDISASNVLLNSDWEPSVSDFGTARFLSSD
SSHRTIVAGTIGYIAPELAYSMVVSERCDVYSFGVVALETLVGSHPKEIFSSLQSASTEN
GITLCEILDQRLPQATMSVLMEIVSVAIVAFACLNANPCSRPTMKSVSQCFLTQLTPLDI
PLREISLQQLMSQELRHYLNL
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttcttgttatttgcagtgttgttattatggggataacattggagttagaagcc
gtgcctacaccgtcgcagcttcaattggaagaaaatgctataatcaatagtggatggtgg
aatagatcaaagtcagtagcttcacgtaatatctgttcatggtatggtatgtcttgcaac
gtcgctggaagcataactagaatcaactatcccttttatacacctgggattcgattagca
acactaaacctctctgctttcaagaatttagaatggcttgaggtctcaaactgtggacta
caagggactatcccatctgatattggtgatctccctaaacttactcatcttgatttgtcc
cataattctcttcatggtgaaatacctccttcattggcaaatcttacccaattaaagtcc
ctaatcatctctcacaacaaatttcaaggccccattcctggtaagttgttgtttctaaaa
aatcttactgggttaaatttgtcctataattcacttgatggtgagatacctcctgtactg
gcaaatcttacccagctagagaacctagacctttcaaacaacaaatttcaaggccccatt
cctggtgagttgttgtttctaaaagatcttaattggttagatttgtcctataattcactt
gatgatgagatacctcctgcactggtaaatcttaccgagttagagagactagacctttca
aacaacaaatttcaaggccccattccagcggagcttggacatttgcttctatctgtgcaa
aatgtcaacgtgaacctttcattcaataatttgaagggtcccattccatatggtttaagt
gagattcagctaatagggaacaaggatgtatgtagccatgattcctattacatagataaa
tatcaattcaagcgttgttctgcccaagacaacaaagtaaggctcaatcagcagctggtc
atagttctccctatcctcatttttctaatcatgctcttcttactactcgtgtgtctgagg
cacactcgcattgcaactaagaacaaacatgcaaacacaacggcagccactaagaatggg
gacttattctgtatatggaattatgatggaaacatagcctatgaagacatcattagagca
acccaagactttgacatgagatattgtattggaacaggtgcctacgggagcgtttatagg
gcacaattaccaagtggcaagattgttgccgtgaaaaaactccacggatttgaagcagag
gtggcagcttttgatgagagtttcataaatgaggtcaaagtattgtcagaaataaagcat
cgacatattgtgaagctccatggattctgcttgcacagaagaatcatgtttttgatatat
gagtacatggagagaggcagcttgttttcagtgttgtttgatgatgtggaagccatggaa
ttggattggaaaaagagggttagcattgtgaaaggcactgcacatgctctttcctatctt
catcatgacttcactcctccaattgtgcatagagacatatcagccagcaatgtcttgctt
aactcagactgggagcccagtgtttcagactttggcacagcccgattccttagctctgat
tcatcccatcgaactatagttgctggaaccattgggtacatagccccagagcttgcatat
agtatggttgtgagtgaaaggtgtgatgtgtacagctttggagtggtggcactcgaaact
ttggtgggatcgcatcctaaggaaatattctcatcacttcaatcagcatctactgagaat
ggcatcacattatgtgaaatattggaccaacgcctcccacaggcaacaatgtcagtttta
atggaaatagttagtgttgccatagttgcatttgcgtgcttaaatgccaatccttgctct
cgcccaacaatgaaatcggtctctcaatgttttcttactcagcttacaccattagacatt
cctttgcgtgagatttcattgcagcagctcatgagtcaagaactcaggcattatttaaat
ttgtga

DBGET integrated database retrieval system