KEGG   Glycine soja (wild soybean): 114397525Help
Entry
114397525         CDS       T06057                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH12, chloroplastic-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    114397525
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gsj03041]
    114397525
Enzymes [BR:gsj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     114397525
Spliceosome [BR:gsj03041]
 Complex C
  Other components
   Step II factors
    114397525
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C IBR OB_NTP_bind HA2 DEAD zf-C3HC4_2 AAA_22 AAA_19 zf-RING_2 zf-C3HC4 zf-RING_UBOX Helicase_RecD ABC_tran AAA_30 ResIII AAA_29
Motif
Other DBs
NCBI-GeneID: 114397525
NCBI-ProteinID: XP_028215398
Position
18
AA seq 1729 aa AA seqDB search
MKKSSYPNPTPRRHDFHRPPPPTHGCGWAPRPAYHRPYHQWRPRFHPHAARIDRPPEPYF
RVELRLGSSPLHRDDVEALIDECHSRHDTFTFYPVDDVAAVLSYRSWEQARDAVVWFWEA
RLAEKHDFTPTLDSNVVVVKDDVDCRLRPVFARHVKGLTEGKEVKRWMEESERLSKEISR
LSSSLSKPLRLGVHNELVEKKKGLVDEKNLVERRLKEFESAMQCLLKYLEGGVDVEGVTV
FRFDGGFDWKRIHCLIKRECRRLEDGLPIYAYRSDILQEIHYQQIMVLIGETGSGKSTQL
VQFLADSGIGTDESIVCTQPRKIAAKSVAQRVQEESIGCYEGQSIKCCSTFSSSREFDSR
IAFMTDHCLLQHYMSDNNLSGVSCIIIDEAHERSLNTDLLLTLLKSLLCRRVEMRLIIMS
ATADAKQLSDYFFACGIFRVLGRSFPVDIKYVPSDYAGDSGSAVVASYVSDVVRMATEVH
KTEKEGTILAFLTSQIEVEWACEKFQAPSAVALPLHGKLSSDEQFRVFQNYTGKRKVIFS
TNLAETSLTIPGVRYVIDSGLVKDSRFDPGSGMNVLKVCWISQSSADQRAGRAGRTEPGV
CYRLYTEADYQSMDLNQEPEIRRVHLGVAVLRILALGVKDVQGFDFVDAPSPSSIDMAIR
NLIQLGAIELNNDVHDLTSEGWCLVRMGIEPRLGKLILGCFKHGLGREGIILAAVMANAS
SIFCRVGNEFDKQRSDCLKVQFCHCDGDLFTLLSVYKEWEALPRERKNKWCWENSINAKS
MRRCQDTILELETCLEREHDVVTPSYWRWDPCMPSNHDKNLKRVILFSLAENVAMYSGCN
QLGYEVAQTGQHVQLHPSCSLLVFAQKPSWVVFGELLSISNQYLVCVSAFDFQSLYDLCP
APLFDVSKMEERKLLMKTLSGLGCILLKRFCGKANCNLLALVSRIRKACMDERIFIEVNV
DNNEIHLYASSNDMDIALGLVNDVLEYERKWLRTECMDKFLYHGSGFSPPVALFGSGAEI
KHLELEKRSLSVDVCHPNINEIDDKELLMFFEKNTSGCICAVHKFTGNTRDEDRDKWGRI
TFMSPDIVRRAAELDGREFCGSSLKVVPSQLGGDKTFSFPAVKARISWPRRLSRGFAIVK
CDIKDVDYILRDFYNLAVGGRYVRCEVGKKSMDSVVINGLDKELSEAEISDVLRTATTRR
ILDFFLVRGEAVGNPPCSALEEALLKEIYPFLPKRNPHISPCRVQVFAPEPKDAFMRALI
TFDGRLHLEAAKALEQIEGKVLPGCLSWQKIKCQQLFHSSLTFPTPVYRVIKEQLDEVLA
SFRNLKGLECNLDRTFNGSHRVKITANATRTVAEVRRPLEELLRGKTIEHDSLTPAVLQL
MLSRDGFSLKNSLQQETGTYILFDRHNLNLRVFGSPNMVALAQEKVIQSLLSLHEEKQLE
IHLRGRDLPPDLMKQMIKNFGPDLHGLKERVPGVDLTLNIRRHIIILHGSKELKPRVEEI
VFEIARSSHHLVERFGNGPSCPICLCEVEDGYRLEGCGHLFCRMCLVEQFESAIKNQGTF
PVCCTHRDCGDPILLTDLRSLLFGDKLEDLFRASLGAFVATSGGTYRFCPSPDCPSIYRV
ADPGSAGEPFVCRACYSETCTRCHLEYHPYLSCERYKEFKEDPDSSLIEWCRGKEQVKCC
SACGYVIEKVDGCNHVECKCGKHVCWVCLEFFSTSNDCYDHLRTIHLTI
NT seq 5190 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatcctcctaccctaatcccacccctcgccgccacgattttcaccgtccgcca
ccacccacccacggctgcggttgggctccccgccccgcctaccaccgcccctaccaccaa
tggaggccccgattccacccccacgccgcccgcatcgaccgccctccggagccctatttc
agggtggagctccgcctcggcagcagccccctccaccgcgacgacgtcgaggccctgatc
gacgaatgccactcccggcacgacaccttcactttctaccccgtcgacgacgtcgccgcc
gttctcagttaccggagctgggagcaggcgcgagacgccgtcgtttggttctgggaggcg
cggctcgcggagaagcacgatttcacgccgacgctggattccaacgtcgtcgtcgtcaag
gacgatgtggattgtcgccttcgaccggtgttcgcgaggcacgtgaaagggttgacggaa
gggaaggaggtgaagcggtggatggaggagagtgaacggttgtcgaaagaaatttctcgg
ctttcgagttcgctgagtaagcccttgcgacttggcgtgcacaacgagttggtggagaag
aagaaagggcttgttgatgagaagaatcttgttgaaaggaggttgaaggagtttgagtct
gcgatgcagtgtttattgaagtatttggagggtggtgttgacgtggagggtgtgactgtc
tttaggtttgatggaggttttgattggaagcggattcattgtctgatcaaaagggagtgt
cggaggcttgaggacgggttgcctatttatgcttaccggagtgatattcttcaggaaata
cattatcaacagataatggtattaatcggagagactggttctgggaagagtacgcagttg
gtacagtttcttgctgattcaggcattggtactgacgaatccattgtgtgcacccaacct
cgcaagattgctgccaaatcagtggctcaaagggtccaggaagaaagcattggatgttat
gaaggccaatcaatcaaatgctgttctacattttcatcctcacgtgagtttgattccagg
atagcattcatgacagatcattgtttattgcagcactacatgagtgataataatttatcc
ggggtctcgtgcatcataattgatgaggctcatgagaggagcttaaatacagatttactg
ttgactttgttaaagagtttactttgtaggagggttgaaatgagacttatcattatgtct
gctacagctgatgcaaagcagctgtctgattacttttttgcttgtggaatttttcgtgtg
cttgggagaagctttccagtggatatcaaatatgttccttctgactatgcaggagattct
ggttctgctgttgttgcctcatatgtttctgatgttgtcagaatggcaactgaggttcac
aaaactgagaaagagggaactattcttgcctttttgacctctcagatagaagtagaatgg
gcctgtgaaaagtttcaagctccctctgcagtagctttgcccttgcatggaaaactttct
tctgatgagcaattccgtgtttttcagaactacactggaaagagaaaagtgatattttca
acaaatcttgcagagacatcacttacgattcctggtgttaggtatgtgatagattctggg
ctggttaaagacagcagatttgatcctggtagtgggatgaatgtacttaaggtttgctgg
atcagccagagctctgctgatcaacgggctggtcgtgctgggaggactgagcctggtgtg
tgctatagactgtacacggaagctgattatcagtctatggacctaaatcaagagccggag
attcggagagttcatcttggtgtagcagttctgaggatccttgctttaggagtgaaggat
gtgcaaggttttgattttgtggatgctccaagtcctagctccatagatatggcaatcaga
aatctaattcaattaggagccattgaactgaacaatgatgttcatgatttaacttctgaa
ggttggtgcttggtaagaatgggaattgaacctaggctgggtaaacttattcttggttgt
ttcaaacatggtttgggtagggaaggtatcatccttgctgctgtgatggccaatgctagt
agcatcttttgcagagttggcaatgaatttgataaacaaagatctgattgtcttaaagtg
caattttgccattgtgatggtgacctctttactcttctctccgtgtacaaggaatgggaa
gctttgcctcgagaaaggaagaacaaatggtgttgggaaaacagtatcaatgccaaatcc
atgaggaggtgccaagacacaattttggagttagaaacttgccttgagcgtgaacatgac
gttgttactccgagttactggcgttgggatccttgtatgccctctaatcatgataagaat
ttgaaaagggtaatactgttctcacttgctgagaatgtagccatgtactccggctgcaat
caacttggttatgaagtggcacaaactgggcaacatgttcaactacatccatcttgttca
ttgcttgtatttgctcagaaaccaagttgggtagtttttggtgagcttctttccatttcc
aatcaatatttggtctgtgtgagtgcatttgattttcaatcattatacgacctttgccct
gctcccctgtttgatgtatccaaaatggaagagcggaagttgctaatgaagacactgtct
ggtcttggctgtattcttctcaagagattttgtggaaaagccaactgcaatttgcttgct
cttgtttcacgtataaggaaagcttgtatggatgaacgcatcttcatcgaagtgaatgtt
gacaataatgaaatccacttatatgcctcttcaaatgatatggatatagcccttgggttg
gttaacgatgttctagaatatgagagaaagtggttacgcactgaatgtatggataagttt
ttgtatcatggttctggtttctctccacctgtagctttgtttgggtctggtgctgagata
aaacatttggaacttgagaaacgttccttgagtgttgatgtgtgtcatccaaacataaat
gaaattgatgacaaggagctcttgatgttttttgagaagaatacctctggttgcatctgt
gctgtgcacaaattcacaggcaatacgagggatgaagatagggataagtggggcaggata
acatttatgtccccagatattgtcagaagagctgctgagctagatggacgggagttttgt
ggctcatccttaaaagttgttccttcacagttgggaggggataaaacattttcgttccct
gctgttaaagcaagaatttcttggcctcgtaggcttagcaggggatttgccatagttaaa
tgtgatataaaggacgttgattatatcttgagagatttctataaccttgcagtaggaggg
aggtatgttcgatgtgaagttggcaaaaagagtatggacagtgttgttataaatgggctt
gacaaagagctttcggaagctgaaatatcagatgtgctaagaactgctacaactagaagg
attttggattttttcttggtgagaggggaagcagttggaaatccaccatgcagtgctttg
gaagaggcactcctaaaagaaatttacccctttttgcccaaaaggaaccctcacattagt
ccttgccgagttcaggtgtttgcacctgagcccaaggatgctttcatgagagctttaatc
acttttgatggaagattacatttagaggcagcaaaagctttggagcaaattgaaggaaag
gtgttacctggatgtctttcatggcaaaagataaagtgccagcagttgtttcatagctcc
cttacatttcctactccagtgtatcgtgtgattaaggaacaactggatgaagtacttgca
agcttcaggaatttgaaaggtcttgaatgcaacctggacaggacatttaatggttctcac
cgagtgaagataacagcgaacgccacaaggacagtggcagaagttagaagacctctggaa
gaactattgagagggaaaaccattgagcatgacagcctcacccctgcagttctccaactc
atgttgtccagagatggctttagtcttaaaaactcattgcagcaagagactggaacttat
attctttttgacaggcacaacttgaatttacgggtgtttggttccccaaacatggttgct
ttggctcaggagaaggtgatacagtccctcctttctctccatgaagaaaagcagttagaa
attcatctgagagggagggatctacctcctgatttaatgaagcaaatgattaagaatttt
gggccagatctccatggattgaaagagagggtacctggggtagatcttacactgaacata
cgtcgccacataatcattcttcatggtagcaaggagttgaaaccgagagtagaggaaata
gtttttgagattgctcgttcaagccatcatttggttgagagatttggcaatggacccagt
tgcccaatttgcttgtgcgaggttgaggatggataccggcttgaaggctgtggccatttg
ttctgccggatgtgtttggttgagcaatttgaatctgctattaaaaaccaaggcactttc
ccggtatgttgtactcacagggactgtggagatcccatcctgcttacagatttgagatct
cttttatttggtgataagttggaggatcttttcagggcttctttgggagcttttgtggca
acaagtgggggaacttacaggttttgcccttctcctgactgcccctcaatttatcgagtt
gcagatcctgggtctgctggcgagccatttgtttgtagggcttgttattcagagacttgt
accaggtgccacttagagtatcatccttacctttcatgtgagagatacaaagaattcaag
gaagatccggattcatctctgatagaatggtgcagagggaaagaacaagttaagtgctgc
tcggcatgtggatatgtaattgagaaggtagatgggtgcaaccacgttgaatgcaagtgc
ggaaagcatgtctgctgggtttgtttagagttctttagtactagtaatgactgttatgac
catttaagaactatacacttaaccatataa

DBGET integrated database retrieval system