KEGG   Glycine soja (wild soybean): 114398048
Entry
114398048         CDS       T06057                                 

Definition
(RefSeq) phenolic glucoside malonyltransferase 1-like
  KO
K13264  isoflavone 7-O-glucoside-6''-O-malonyltransferase [EC:2.3.1.115]
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj00943  Isoflavonoid biosynthesis
gsj00944  Flavone and flavonol biosynthesis
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00944 Flavone and flavonol biosynthesis
    114398048
   00943 Isoflavonoid biosynthesis
    114398048
Enzymes [BR:gsj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.115  isoflavone-7-O-beta-glucoside 6''-O-malonyltransferase
     114398048
SSDB
Motif
Pfam: Transferase Condensation
Other DBs
NCBI-GeneID: 114398048
NCBI-ProteinID: XP_028215970
Position
19
AA seq 463 aa
MAESPTFKVHEVCSISPPQETPPTTLPFTLFDVLWLRFPPVERLFFYSFPNPTTTSFFDT
TVLPNLKHSLSLTLHHFPPLAGTITWPNHSPLPLITYTPGNTIPFTIAQSNADFNTLSSN
LSQVNHHLQNLIPHLTISHEEASVLALQLTLFPNQGFSIGITTHHAALDGKSSTLFIKSW
AHFCSQLNTSPEEPLSLPKHLIPSFDRSVIRDTLGIGEIYANSWMNFGGATNDRSLNVWD
SLGGSQTDLVKGLFELTPLDIKKLKKLAESKVVVGDNKKKIRVTSFTVTCAYLLSCAVKA
EQPNCERVPFIFSVDCRARLDPPIPGTYFGNSVVSLLVIAKREELLGEEAFFKSVLGISE
ELNRIEGDVLNGADRWMPKIQSVMSERPRLFSVAGSPRFEVYDVDFGWGRPKKVDVTSVD
KTGAFSLSETRDHSGGIQIGLALTKSQMEAFSTVFAQGLESLE
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggcagagtcaccaaccttcaaagtccatgaagtctgctccatttcgccgccacaagaa
accccaccaacaactcttcccttcaccctcttcgacgtcctatggcttcggttcccccca
gtggagcgtctcttcttctattccttcccaaacccaacaacaacatcatttttcgacacc
accgttctcccaaatctcaaacactccctctccctcactctccaccacttccctcctctc
gccggcaccatcacatggcccaatcactcacccctccctctcataacctacactcccggc
aacaccatccccttcacaatcgcccaatccaacgcagatttcaacaccctctcttcaaac
ctctctcaagtcaaccaccacctccaaaacctaataccccacttaaccatttcccatgaa
gaagcttccgtgttagcacttcaactcaccctcttccccaaccaaggcttttcgattgga
atcacaacccaccacgctgcacttgatggaaagtcttcgactttgttcatcaaatcgtgg
gcgcatttttgttctcagcttaatacctccccagaagaaccgttatcactaccaaagcat
ctaataccctcgtttgatagatctgttataagagacactttggggatcggtgagatttac
gcgaactcatggatgaacttcggtggagccaccaatgaccgaagcttgaatgtgtgggat
tccctcggtggaagtcaaaccgatttggttaaagggttgttcgagttgacaccgttggat
atcaagaagctgaagaaattagcggagtctaaggttgttgtcggagacaacaagaagaag
attagggtgacatcgttcacggtcacgtgcgcttacttgttgtcatgcgcggtgaaagcg
gagcaacccaactgcgaaagagtgccttttattttcagcgtggactgtagggcgcgtttg
gatccaccaattccgggaacgtactttgggaacagcgtcgtgtctttgttggtgatagca
aagcgagaagagctattgggggaagaagcgttttttaaaagcgttttagggataagcgaa
gagttgaacaggatagagggtgacgtgttgaacggtgcggacaggtggatgccgaagatt
caatcggtgatgtcggagaggccgaggttgttctctgttgcggggtctccgaggtttgag
gtttacgatgttgactttgggtggggaaggcctaagaaagtggatgttacttccgttgat
aaaacgggtgcgttttcactttcggagactagggatcacagtggaggcattcaaattggg
ttggcgttgaccaagagtcaaatggaggcgttttctacggtttttgctcaagggcttgag
tccttggaataa

DBGET integrated database retrieval system