KEGG   Glycine soja (wild soybean): 114399245Help
Entry
114399245         CDS       T06057                                 

Definition
(RefSeq) putative serine/threonine-protein kinase isoform X1
Organism
gsj  Glycine soja (wild soybean)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH ABC1 Kinase-like
Motif
Other DBs
NCBI-GeneID: 114399245
NCBI-ProteinID: XP_028217192
Position
19
AA seq 435 aa AA seqDB search
MCQRLSLAQLKSQPRCSFSQFLLIIAISKTFTNRTPKSNILRIFTLLSSHEESFFFLHLF
LSIDQRTNQARIMDCICNYPTEEPDEDNNDGNFRLFTYRELNSATRGFHPSEKIGEGGFG
TVYKGQLRDGTLVAVKVLSIELDSLRGEREFVAELNTLTNIKHHNLVNLRGCCVEGAHRY
IVYDYMENNSLRYTFLGSEQKRMEFSWETRRDVSIGVARGLAFLHEEHQPHIVHRDIKSS
NVLLDPNFTPKVSDFGLAKLLRDEKSHVTTHVAGTLGYLAPDYASSGHLTRKSDVYSFGV
LLLEIVSGQRVVDAYQNGERFIVEKAWAAYEANDLLRMVDPVLNNNYPAEEVKRFLMVGL
RCVQEMARLRPRMSEVLDMLTNNVDMGEFSVSKPGLVTDLRSARIRSQMNPSEESSVTAA
TFADSSGWSTANLAR
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcaaagacttagcttagctcagctcaaatcacaacctcggtgttctttctctcaa
tttcttctcataattgccatctccaaaaccttcacgaaccgcacacccaaatccaacatc
ctacgaatttttacacttctctcgagccatgaagaatcctttttctttttgcacttgttt
ctcagcatcgatcaaagaacaaaccaagcacgaattatggattgcatctgtaattaccca
acagaggagccagatgaagataataatgatggcaactttcgcttattcacgtatagagaa
ttgaattctgccacacgtggttttcacccatcggaaaagattggagaaggaggctttggc
actgtctacaaggggcagcttcgggatggaactttggtggcagtgaaagtgctttcaatt
gagctagattccttgagaggagagagggagtttgtggcagaattgaatacactaacaaat
atcaaacaccacaatcttgtcaatctccgagggtgttgtgtagaaggagcccacagatac
atagtctacgactacatggaaaacaatagccttcgttacactttcttaggttcagagcaa
aaaaggatggaattcagctgggaaactcggagggatgtatccataggtgtggccagaggg
cttgcctttctccatgaggaacatcaaccccatattgtgcatagagatatcaaatccagc
aatgttcttcttgatccaaattttacaccaaaagtctcggattttggcttggccaagcta
ctaagagatgaaaagtcccatgtcactacccatgttgcaggcacattgggttatcttgca
ccagactatgctagttctggacacttgacacgaaaatcagatgtttatagctttggagta
ctacttttggaaattgtcagtggccaaagagtggtagatgcttatcaaaacggggaacgt
ttcatagttgagaaggcttgggcagcatatgaggctaatgatcttctgagaatggtggat
ccagtgctgaataacaactatcccgcggaagaagtgaaacggttcctaatggtggggctg
cgttgcgtgcaagaaatggcgaggcttaggccacgaatgtcagaggttttggacatgttg
accaacaatgttgacatgggagagtttagtgtttcaaaaccaggattagtcactgatctc
aggagcgccagaataaggagccaaatgaatccatcagaagaatcaagtgttactgcagca
acctttgcagactcctctggatggagtaccgccaatcttgcccgttag

DBGET integrated database retrieval system