KEGG   Glycine soja (wild soybean): 114406717Help
Entry
114406717         CDS       T06057                                 

Definition
(RefSeq) insulin-degrading enzyme-like 1, peroxisomal
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
gsj  Glycine soja (wild soybean)
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gsj01002]
    114406717
Enzymes [BR:gsj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     114406717
Peptidases and inhibitors [BR:gsj01002]
 Metallo peptidases
  Family M16: pitrilysin family
   114406717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 114406717
NCBI-ProteinID: XP_028225298
Position
3
AA seq 964 aa AA seqDB search
MAVGKEDVEIVKARIDKRDYRRVVLRNSLQVLLISDPDTDKCAASMDVGVGYFSDPAGLE
GLAHFLEHMLFYASEKYPVEDSYSKYITEHGGSTNAFTSSEHTNYFFDVNTDGFEEALDR
FAQFFNKPLMSADATMREIKAVDSENQKNLLSDAWRMNQLQKHLSDEDHPYHKFSTGNWD
TLEVRPKAKGLDTRSELLKFYEENYSANLMHLVIYTNESLDKIQNLVEEKFQDIRNINKT
CFRARVQPCKSEHLQILVRTVPIKQGHKLRIVWPVTPEIHHYTEGPCRYLGHLIGHEGEG
SLYYILKKLGWATALYAGESDWGLDFSFFKVVIDLTDVGHEHIQDIIGLLFKYIELLQQS
GVCKWIFEELSAVCETKFHYQDKIRPSDYAVNIASNMKFYPVKDWLTGSSLPSKFSPNVI
QMVLDQLSPNNVRIFWESKKFEGLMDKVEPWYGTAYSLEKITGSAIQGWVLSAPDENMHL
PAPNKFIPTDLSLKIVQEKVKFPVLLSRSTYSALWYKPDTLFSTPKAYVKIDFNCPYSGN
SPEAEVLTHIFTELLMDYLNEYAYYAQVAGLYYSINQTDGGFQMTLRGYNHKLRILLETI
VEKIVTFEVKTDRFSVIKEMVTKEYQNLKYQQPYQQAMYYCSLILQDQTWPWIEQLDILP
ALQVEDLAKFVPAMLSRTFLEFYIAGNIESHEAQSIVKHIEDVLFNFSKPLCKPLFSSQH
LENRVVKLESGMNYFYPSECLNPEDENSALVHYIQVGRDDFKLNVKLQLFALVAKQPTFH
QLRSVEQLGYITVLMQRNDCGIRGLQFIIQSTVKSPGNIEQRVEAFLQMFETKLHEMTID
EFKSNVNALIDVKLEKHKNLREESSFFWREINDGTLRFDRTDYEVEALRQLTLQELIDFF
NEYVKVGAPRKKTLSVRVHGNRHSSEYKTEASEPHLAKIDNIFTFRRSQALYGSFKGLSG
QMKL
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggcagtggggaaggaagacgtggagatcgtgaaggcgcgcatcgacaagagggattac
agaagagtcgtgctccgcaattcgctccaagtgctcctcattagcgatcccgataccgat
aagtgtgctgcttcaatggacgttggcgtcggttacttcagcgaccctgctggcctcgaa
ggcctcgcccatttcctcgagcacatgctgttttatgcgagtgaaaaatacccagttgaa
gatagctactccaagtatattactgagcatggaggaagcaccaatgcttttacatcttct
gaacacaccaactatttttttgatgttaacacagatggctttgaagaggctctggacaga
ttcgctcagttcttcaataaaccattgatgtctgccgatgccactatgagggaaattaaa
gctgttgactctgaaaaccagaagaatttattatctgatgcatggagaatgaaccagctt
cagaaacatctcagtgatgaagatcatccgtatcataaatttagtacagggaactgggac
actttggaagttagaccaaaagcaaaaggattagatacaaggagcgagcttctcaaattc
tatgaagaaaactattctgctaatctaatgcatctagttatatacacaaatgaaagcctt
gataaaattcaaaaccttgtagaagaaaagttccaggatattagaaacatcaacaaaact
tgtttccgtgctcgtgttcagccgtgcaaatcagagcatttgcaaattcttgtcaggact
gtcccaataaagcaaggtcataaattgagaattgtatggccagtaacccctgaaattcat
cattacactgaagggccatgcaggtatcttggtcatctaattggtcatgaaggagaaggg
tctttatattacatcttgaaaaaattgggatgggctacggccttgtatgcgggcgaatca
gattggggtttggacttttctttctttaaagttgtaattgatcttactgatgttggtcat
gagcacatacaagatatcattgggttgttgttcaaatacattgagcttctacaacagtct
ggtgtttgcaaatggatttttgaagagctttcagcggtttgtgagaccaagtttcattat
caggacaaaattcgtcctagtgattatgctgttaatattgcatcaaatatgaagttttat
cctgtaaaagattggttgacaggatcatccttgccttctaaatttagcccaaatgttatc
caaatggtactagatcagctttctccaaacaatgttcgaatcttttgggagtctaaaaaa
tttgaagggcttatggataaggtagagccatggtatggaactgcatattcccttgaaaaa
atcactggctctgcaattcaggggtgggtgctttctgctccagatgaaaatatgcatctt
ccagctcctaacaaattcattccaactgacttgtcacttaaaattgtgcaagaaaaagta
aagtttccagttttgttaagcaggtctacttattcagccttatggtataagccagataca
ttgttttctacacccaaggcttatgtaaagattgatttcaattgcccatattctggaaac
tctcctgaggctgaagttttgacgcatattttcacagagttattgatggattacttgaat
gaatatgcttattatgctcaggttgctggtttatattacagcataaatcaaacagatggt
ggtttccagatgactctccgtggttacaatcacaagttaaggattctacttgaaactata
gttgaaaagattgtgacatttgaagtgaaaactgacaggttttcagttatcaaggaaatg
gtaaccaaagaataccagaatttgaagtaccaacaaccttatcagcaggctatgtactat
tgctctttgattttacaagatcaaacctggccttggatagaacagctagacatacttcct
gctcttcaagttgaagatcttgctaaatttgtaccagcaatgctctccaggaccttttta
gagttttatatagcagggaacattgaaagccatgaagcacagtcaattgttaagcacata
gaagatgttctctttaatttttcaaaacctctgtgcaagcctttattctcatctcaacat
ttggaaaatcgggttgttaaacttgaaagtggcatgaattacttctacccttcagaatgt
cttaatcctgaagatgagaattctgctcttgtgcactatatacaggttgggcgagatgac
tttaagctgaatgttaaacttcagctttttgcccttgttgcaaagcaaccaacctttcat
cagctacgatcagttgagcagctggggtacattactgtgctcatgcagaggaatgattgt
ggcatacgtggactacagtttattatccaatccacagtaaagtctcctggtaacattgag
caaagggtcgaggcatttctccaaatgtttgagaccaaactccacgagatgacaattgat
gaattcaagagtaatgtaaatgctttgatagatgtgaagctagagaaacacaaaaatttg
agggaagagtcatcatttttctggcgagagattaatgatggtactttgaggtttgatagg
acagactatgaggttgaagcattaaggcagctcactcttcaagaattgatagatttcttc
aatgaatatgtcaaagttggtgcacctcgaaagaaaactttaagtgtacgagtacatggg
aaccgtcattcatctgaatacaaaacggaagcctcagaaccacacttggctaaaatagac
aatatctttacttttagaagatcacaggctctttatggttcatttaaaggactttctggg
cagatgaaattatag

DBGET integrated database retrieval system