KEGG   Glycine soja (wild soybean): 114407663Help
Entry
114407663         CDS       T06057                                 

Definition
(RefSeq) protein HASTY 1-like
  KO
K14289  exportin-5
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj03013  RNA transport
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    114407663
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gsj03016]
    114407663
   03036 Chromosome and associated proteins [BR:gsj03036]
    114407663
Transfer RNA biogenesis [BR:gsj03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    114407663
Chromosome and associated proteins [BR:gsj03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     114407663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1
Motif
Other DBs
NCBI-GeneID: 114407663
NCBI-ProteinID: XP_028226645
Position
3
AA seq 1206 aa AA seqDB search
MEDSVSSSNMNATNVAQAIHTALDWASTPNARQNAVAFLDSIKNGDVRVLANTSFLLVKK
SWSSEIRLHAFKMLQHLVRLRWEELRPAEHKNFANLSVDLMSEIADPCENWALKSQTAAL
VAEVVRREGLNLWQEMLPSLVSLSSKGPIEAELVAMMLRWLPEDITVHNEDLEGDRRRLL
LRGLTQSLPEILPLLYTLLERHFTAAMNEAGRKQMDIAKQHAATVTATLNAVNAYAEWAP
LSDFAKSGIIHGCGVLLSAPDFRLHASEFFKLVSPRKRPIDASASEFDQAMSSIFQILMN
VSREFLYRSGSGPGSMDEGEYEFAEFICESMVSLGSYNLQSIAGDSTILPLYLEQMLGFF
QHFKFGIHFQSMHFWLVLMRDLMSKPKNSTHSAADSSAVSSTGSGEVENAKKKTLSFVSD
DFCGAILDTSFPRMLKREKILHETAISLGALELWSDDFEGKGTFSQYRSRLLELIRFVSF
YKPLIAATKVSEKIDTIIKGLLLSSAPTQDLAVMESMQLALENVVNAAFDGSNDFTKANA
EVQLALCRTFEGLLQQFISLKWTEPALVEVLVHYLDAMGPFLKYFPDAVGSVINKLFELL
TSIPLVIKDMSMHNARHARLQTCTSFIRIAKTADKSILPHMKGIADTMGCLQREGRLLQG
EHNLLGEAFLVMASSAGIQQQQDVLRWLLEPLSIQWTQSEWQDKYLSGPHGLVQLCSDAP
VMWSIFHTLTFFERALKRSGLKKANWNSENSSTPNSTPLNPMASHISWMVTPLLKLLRCI
HSLWSPSVSQALPGEVRAAMVMGDVERFSLLGEGNSKLPKGVTDGSKVDMNKEGYAEPNE
SDIRNWFKGIRDSGYNVLGLSTTVGDSFFKYLDVHSVAVALMENIQSMEFRHIRQLVHST
LIPLVKNCPLDMWEIWLEKLLHPLFVHAQQALSCSWSSLLQDGRAKVPDVHDILSGSDLK
VEVMEETILRDLTREMCSLLSVIASPPLNTGIPSLEQSGHVSRLDMSSLKNLDTVASCSM
VGFLLKHEGLALPTLRMCLEAFTWTDGEAVTKISSYCSALVVLAIVTNHAELIEYVSRDL
FTSIIKGLALESNAIISADLVGICREIFVYLCDRHPAPRQVLMSLPNITTHDLVAFEESL
TKTFSPKEQKQLTRSLFQLATGNKLKALAAQKTVNIITNVSTRPRPANAPESKVDDGDVV
GLAAIM
NT seq 3621 nt NT seq  +upstreamnt  +downstreamnt
atggaggatagtgttagtagcagcaacatgaatgccaccaatgtggcgcaagctatacat
accgcccttgattgggcctctactcccaacgcgagacaaaacgccgtcgcttttctcgat
tccataaaaaacggcgatgtacgggtattagcaaacacatcattccttctggtgaaaaag
agctggtcatctgaaatccggttacatgcctttaaaatgctgcagcatttggtgcgctta
cgttgggaggaattaagacctgcagagcacaagaactttgcaaatctttctgttgatttg
atgtctgagattgctgatccttgtgaaaattgggctctcaaaagccagacagctgccctt
gttgctgaggtagttagaagagagggtcttaatttatggcaagaaatgcttccatctttg
gtttctctatccagcaagggtccaatagaagcggagttggttgcaatgatgctgcggtgg
cttcctgaagatattacagttcacaatgaagacttagaaggtgaccggcgaaggctactt
ttgcgtgggctaactcaatcattgcctgaaattttgcccctattatacactttactagaa
aggcactttacagctgcaatgaatgaagctggtaggaaacagatggatattgccaaacag
catgctgccactgtaacagctactctaaatgctgtgaatgcatatgctgagtgggctcca
ttgtcagattttgctaagtctggcatcattcatggttgtggtgtactactatctgcaccg
gattttcgtcttcatgcttcggagtttttcaaacttgtctctccaaggaagaggcctatt
gatgcatctgcttctgaatttgaccaagctatgagcagcatctttcaaatattgatgaat
gtatctagagaatttttgtatagatctggttcaggtcctgggtccatggatgagggcgaa
tatgaatttgctgaatttatatgtgaaagtatggtgtcgctgggttcttataacttgcaa
agtattgctggtgatagcaccatacttccactttaccttgaacagatgctgggatttttc
caacatttcaagtttggtattcattttcaatccatgcacttctggctggtgctaatgagg
gatttgatgtcaaagccaaaaaattccacacattcagctgctgacagttcagctgtgagt
agcacaggttctggagaagttgaaaatgctaagaaaaagactctaagctttgtgagtgat
gatttttgtggtgcaattttagatacatctttccctcgcatgctcaagagagagaaaatt
ctgcatgagactgccatttctttaggggcattagagttgtggagtgacgattttgagggc
aagggaactttcagccagtatcgttctagactgttggagttgattaggtttgtttccttt
tacaaacccctgatagctgctactaaagtttctgaaaaaattgatacaatcatcaaaggt
ctcttgctttcatcagcaccaactcaggacttagctgtgatggaaagcatgcagttggct
ttagagaatgttgtaaatgcagcttttgatggatcaaatgactttaccaaggcaaatgct
gaagttcagttagcattatgtagaacgtttgaaggtttacttcaacaatttatttcctta
aaatggacggagcctgcacttgttgaagtacttgttcactatttggatgctatgggcccc
tttttgaagtatttcccagatgcagttggcagtgttatcaataaattatttgaactttta
acatctattccccttgtaatcaaggatatgtcaatgcataatgcacggcatgcaaggctg
cagacctgtacatcatttattcggatagcaaaaactgctgacaaaagcatcttgcctcat
atgaagggtattgctgatacaatgggatgtttgcaaagggagggtcgtttgcttcaggga
gagcataatcttttaggtgaagcttttcttgttatggcttcttctgctgggatccaacag
caacaagatgttttaaggtggttactagaacctttgagcattcagtggacacaatcggag
tggcaggataaatatttgtcaggtccacacggtttggttcagttgtgctcagatgcgcct
gttatgtggtcaatttttcatacattgacattctttgagagggcacttaagaggagtgga
ttgaagaaagccaattggaattcagaaaacagctcaacaccaaactcaactcctttaaat
ccaatggcctctcacatatcatggatggtgactcctctcttgaaactactgcgctgtata
cattccctttggtctccatctgtaagtcaagctttacctggtgaggtcagagctgcaatg
gtcatgggtgatgttgagaggttcagtcttcttggagaagggaactctaaattaccaaag
ggtgtcacagatggatctaaggttgacatgaataaagaaggatatgctgaacccaatgaa
tcagatatacgaaactggtttaaaggcatcagagacagtggatataatgtattgggtttg
tcaacaaccgttggggattcttttttcaaatatttggatgtgcactctgttgctgttgca
ctaatggagaatatacagtcaatggagttcaggcatataaggcagcttgttcattccact
ttgattcctttggttaaaaattgtcctttggatatgtgggagatttggctggaaaagctt
ctacacccattgtttgtccatgctcagcaggcacttagctgttcatggtctagtcttcta
caagatggtagagcaaaggttccagatgttcatgacattcttagtggatcagacttgaaa
gtggaagtgatggaggaaacaattctgagggatctcacacgtgagatgtgttcactcctc
tctgtcattgcttctcctccccttaatactggaatcccttctttggaacaatctgggcat
gttagtcgattagatatgtcttctctaaaaaacttggatacagttgcatcatgctccatg
gttggtttccttctaaagcatgaaggtctggcccttccaacactacgaatgtgtttggaa
gcttttacatggacagacggtgaagctgtgactaaaatttcttcatattgctctgcattg
gtagttcttgcgatagtaacaaatcacgcagaactcattgaatatgtttctagagatctt
tttacatccattattaaaggtttagcccttgaatcaaatgcaataatcagtgctgatcta
gttggcatttgtcgtgaaatatttgtttacctttgtgatagacacccagctcccaggcag
gttttgatgtctctccccaatattaccactcatgatttagttgcctttgaggaatcttta
acgaaaacattcagtccaaaggaacaaaagcagcttacgagaagcttgtttcaattagca
actggtaacaaattgaaagcacttgcagcacagaaaaccgtgaatatcattacaaatgtt
tcaacaagaccgcgcccagccaatgctcctgagtccaaagttgatgatggtgatgttgtg
gggttggcagccatcatgtga

DBGET integrated database retrieval system