KEGG   Glycine soja (wild soybean): 114409557Help
Entry
114409557         CDS       T06057                                 

Definition
(RefSeq) DEAD-box ATP-dependent RNA helicase 27-like
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
gsj  Glycine soja (wild soybean)
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gsj03041]
    114409557
   03009 Ribosome biogenesis [BR:gsj03009]
    114409557
Enzymes [BR:gsj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     114409557
Spliceosome [BR:gsj03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    114409557
Ribosome biogenesis [BR:gsj03009]
 Eukaryotic type
  90S particles
   Helicases
    114409557
  Pre-60S particles
    114409557
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII DUF4746
Motif
Other DBs
NCBI-GeneID: 114409557
NCBI-ProteinID: XP_028228848
Position
4
AA seq 542 aa AA seqDB search
MAEAEHNDPTSPEREVQTKSNKKKLRKRKRPHKTEQKRDEDKNDANIDSAQTQTEDEEEE
QKEEDTNNFSSGIMSTESFSSLGLSEPTSKAIADMGFHRMTQIQAKAIPPLLTRKDVLGA
ARTGAGKTLAFLVPAVELLYSIQFTPRNGTGVVVICPTRELAIQTHAVAKELLKYHSQTL
GLVIGGSGRKGEAERIVKGVNLLVATPGRLLDHLQNTKGFIYKNLKCLMIDEADRILEAN
FEEEMKQIINILPKKRQTALFSATQTKKVEDLARLSFQATPIYIDVDDGRKKVTNEGLQQ
GYVVVPCAKRFVVLYSFLRRYQSKKVMVFFSSCNSVKFHADLLKCTGLDCLNIHGKQKQH
ARTTTFFNFCKAEKGILLCTDVAARGLDIPDVDWIVQYDPPDEPKEYIHRVGRTARGEGG
KGNALLFLIPEELQFLHYLKAAKVPVKEYAFDHKKLANVQSQLEKLVAGIYHLNVMAKDA
YRSYILAYNSHSMKDIFNVHRLDLQAVAASFCFSNPPKVNLNIDSSASKHRKKIRKVEGK
RR
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagcagaacacaacgatcccacctcgccggagcgcgaggtccaaaccaaaagc
aacaagaagaaactccgcaagaggaaaaggcctcacaagaccgagcagaaacgagatgag
gacaagaacgatgctaacattgatagtgcccaaacacaaaccgaagatgaagaagaagaa
caaaaagaagaagacacaaacaacttctcatccggaatcatgagcaccgagtctttctcc
tctctgggcttgtccgaacccacttccaaagccattgcggacatgggcttccaccgtatg
actcagattcaagcgaaggcaattccgccgcttctgaccaggaaggacgttctgggcgcg
gcgagaacgggtgcgggaaaaaccctagcgtttttagttccggcggtggagttgctgtac
agcattcagttcacgcctcggaacgggacgggtgttgttgtgatatgcccgacgagggag
ctggcgattcagacgcacgccgtggcgaaggagctgctgaagtatcactcgcagacgctt
gggttggtgattgggggttccgggaggaagggagaggcggagcgcattgtgaaaggggtg
aacctgttggtggcgacgccaggaaggcttctcgatcacctccagaatacgaaggggttc
atatataaaaacttgaagtgcctaatgattgatgaagctgacaggatattggaagcaaat
tttgaggaggagatgaagcagattattaacatacttccaaagaaaaggcaaacagctttg
ttctcagctacccaaacaaagaaggtcgaggatcttgcccgcttatcatttcaggcaact
cctatctatattgatgtagatgatgggagaaaaaaggtcacaaatgaaggattgcagcag
ggctatgttgttgttccctgtgctaaacgttttgttgttctctattcattcttgaggaga
taccaatcaaaaaaagtgatggtctttttctcttcatgcaactctgtcaaattccatgca
gatcttctcaagtgcactgggttggactgtttaaatattcatggaaaacaaaagcaacat
gccaggactactacgttcttcaacttctgcaaagcagaaaaggggatcttgctctgtact
gatgttgctgctcgtggacttgacatacctgatgtggactggattgtgcagtatgatcct
cctgatgaaccaaaggaatatatccacagggttggtagaacagctcgtggggaaggtgga
aaaggaaatgctttacttttcctgattcctgaagaattgcaatttcttcactatttgaag
gcagcaaaggttcccgtgaaagaatatgcgtttgatcataagaagcttgcaaatgtacaa
tctcaactggagaagttggtggctggcatttatcatttgaatgttatggctaaagatgca
tataggtcatatatattagcatataattcacactccatgaaagatatattcaatgttcac
cgccttgatttacaggctgttgctgcttcattctgtttttctaacccaccgaaggtgaat
ctgaacatagatagcagtgcttcaaagcataggaagaaaatacgcaaagtagaaggaaag
agaagatga

DBGET integrated database retrieval system