KEGG   Glycine soja (wild soybean): 114411969Help
Entry
114411969         CDS       T06057                                 

Definition
(RefSeq) uncharacterized protein LOC114411969 isoform X1
  KO
K06195  ApaG protein
Organism
gsj  Glycine soja (wild soybean)
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    114411969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF525 UVR DUF4354 Anth_synt_I_N
Motif
Other DBs
NCBI-GeneID: 114411969
NCBI-ProteinID: XP_028231522
Position
5
AA seq 265 aa AA seqDB search
MQSLSLSMSLRSSSLANFLLLSSETRVRRRRRSVIVACALEGDSGSSSTSSFLSRTQTYA
LLKQQLQVAAKSEDYKEAARIRDSLKQFEDEEPVLRLRRLLKEAIAEERFQDAASYRDEL
NNIAPHSLLKCCSDATTLGIRVQVRSVYIEGRSQPSKGLYFFAYRIRITNNSDHPVQLLR
RHWIITDANGRTENVWGIGVVGEQPLILPGNSFEYSSACPLNTPNGRMEGDYEMIHFERV
GSRSFNVAIAPFSLSLLGDDEGCVI
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccttatcgttaagtatgagtctgaggagtagtagtttagcgaattttctgttg
ctgagttcagagacgagagtgagaagaagaagaaggagtgtcatcgtagcgtgtgctttg
gagggagacagtggtagcagtagcacaagctcctttctctctcggacccaaacctacgcc
cttcttaagcaacaattgcaagtggctgctaaatctgaggattacaaggaagcagctaga
attcgagactcgttgaagcaatttgaggacgaggagcctgttttgcgtctgaggagacta
ttgaaggaagcaattgctgaagagagattccaggatgctgctagttaccgtgatgagcta
aacaatattgccccacactctcttttaaaatgttgcagcgatgctacaacattgggaatc
agggttcaagttaggagtgtatatatagagggcagaagtcagccttcaaaggggctatac
ttctttgcatatagaataagaattaccaataactcagaccaccctgttcaacttcttaga
aggcattggattataactgatgctaatgggagaacggaaaatgtctggggaattggagtt
gttggtgaacagccattaatacttcctggaaatagttttgaatactcttcagcatgccca
ctgaacacaccaaatggtagaatggaaggtgattatgagatgatccattttgaaagagta
ggctcacgatcattcaatgtggccattgccccgttttctctctctctgcttggagatgat
gaaggttgtgttatttga

DBGET integrated database retrieval system