KEGG   Glycine soja (wild soybean): 114412143Help
Entry
114412143         CDS       T06057                                 

Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10-like isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    114412143
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gsj03041]
    114412143
Enzymes [BR:gsj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     114412143
Spliceosome [BR:gsj03041]
 Complex C
  Other components
   Step II factors
    114412143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD AAA_30 T2SSE AAA_19 PhoH DUF2075 AAA_25
Motif
Other DBs
NCBI-GeneID: 114412143
NCBI-ProteinID: XP_028231737
Position
1
AA seq 705 aa AA seqDB search
MPSVQRGSFSNRQTQFSERRQKIIQQRKSLPIAPVEKRLVEEVRKHDVLIIVGETGSGKT
TQIPQFLFDAGFCCDGRVIGITQPRRVAAVTVAKRVAEECGVELGQKVGYSVRFDDATSG
LTRIKYMTDGLLLREALLDPYLSKYSVIIVDEAHERTVHTDVLMGLLKSVQLARSSSVSG
GQGLNFGNKNMNKLFEKENDQSGIFLKKPRHEKYAPLKLIIMSASLDARAFSEYFGGAKA
VHIQGRQFPVDIFYTRDAETDYLDASLITIFQIHLEEGPGDILVFLTGQEEIESVERLIS
EKLPQLPQESQKLLVVPIFAALPSEQQMRVFAPSPSGFRKVILATNIAETSVTIPGIKYV
IDPGFVKARSYDPGKGMESLIIIPTSKSQALQRSGRAGREGPGKCFRLYPEREFEKLEDS
TMPEIKRCNLSNVILQLKALGVDDILGFDFIDKPSRAAIIKSLEQLFLLGALTDECQLSD
PVGHQMARLPLDPLYSKALILASQFNCLEEMLITVALLSVESIFYSPRDKLEEARTATKC
FSSPVGDHITLINVYRASNDFLEKRSMEMNMAKTEKVYRKWCKENFINSRSLRHARDIHR
QIQGHVEQMGLNLSSCGDDMLQFCRCLAASFFINAAVKQPDGTYRALASGQMVQIHPSSV
LFRQKPECVIFNELVQTNHKYVRNLTRVDYLWLTELAPQYYAMHN
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcagtgcaacggggaagcttctccaatcgccaaacccaattctccgagcggagg
cagaagattatacaacagaggaagtctcttccgattgctccagttgagaaaagactggtt
gaagaggttcggaagcacgatgtgttgattatcgttggcgaaactggaagtggaaagacc
actcagattccgcagtttctgtttgatgctggattttgttgcgatggaagggttattggg
ataacacaacctagacgtgtggctgctgtcactgtggctaaacgtgttgctgaggagtgt
ggtgttgagttgggccagaaggtcgggtattcagttaggtttgatgatgctacttctggc
ttaacaaggatcaaatatatgacagatgggttgcttttgagggaagcattgttggatcca
tatctttcaaagtattctgttataattgttgatgaagcacatgagaggactgttcatact
gatgtcttgatgggcttgctaaaaagtgtacaacttgctcggtcaagttctgtaagtggt
ggccagggccttaattttggaaacaagaatatgaataagttgttcgagaaagaaaatgat
cagagtggcatttttcttaaaaagccccgccatgagaagtatgctccattgaagttaatc
atcatgtctgcaagtctggatgcacgcgctttctctgagtactttggtggtgccaaagct
gttcacatccaagggagacagtttcctgtagatatattttatacccgtgatgcagagaca
gattatttagatgcttccttgataacaatattccagattcatttagaggagggccctggt
gatatactagtatttctgactgggcaagaagagattgaatctgttgaaaggcttatcagt
gagaaactcccacaattacctcaagaaagtcagaagcttctagttgtgcctatatttgca
gctcttccatctgagcagcaaatgcgggtctttgcaccatctccatctgggtttcggaag
gtgatattggcaactaatattgctgagacatcagtaacaattcccggaatcaagtatgta
attgatcctggatttgttaaagcacgttcttatgaccctggaaaaggcatggaatccttg
attataatacctacatccaagtcccaagctctgcaaagaagtgggcgtgcagggcgtgaa
ggacctggaaaatgcttccgtctatatcctgaaagagaatttgagaaacttgaggactca
acaatgccagagattaagcgttgcaacctttctaatgtcattttgcagcttaaggctttg
ggtgttgatgacatactagggtttgatttcattgataaaccttcaagggcagctattata
aaatcgttggagcagctatttttgttaggtgctctaacagatgaatgtcaactatctgat
cctgttggtcatcaaatggctcgactgcccttggatcctctttattccaaagctcttatt
ttagctagtcagtttaactgcctggaggagatgttgataactgtggcactgctgtctgtg
gaatccatattttatagtcctcgtgacaagttagaagaggcaagaactgcaacgaaatgc
ttctcaagtccagtgggagaccacatcactttgattaatgtgtatcgagcatctaatgat
ttcttggagaagagatcaatggaaatgaatatggcaaagactgaaaaggtttatagaaaa
tggtgcaaagaaaattttattaatagccggtctcttagacatgctcgtgacattcacagg
cagattcagggacatgttgaacaaatgggtctgaatctttcttcttgtggagatgatatg
cttcaattctgcagatgccttgctgcttcctttttcatcaatgcagctgtcaagcagcct
gatgggacatacagggctttggcaagtggtcagatggtgcagatccacccttcttctgta
ttattccggcaaaaaccagagtgtgtgatatttaatgagttggtccaaactaaccataag
tatgtccgaaatttaaccagagttgattacctatggttaaccgagctggctcctcaatat
tatgctatgcacaattaa

DBGET integrated database retrieval system