KEGG   Glycine soja (wild soybean): 114418618Help
Entry
114418618         CDS       T06057                                 

Definition
(RefSeq) putative receptor-like protein kinase At4g00960
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
gsj  Glycine soja (wild soybean)
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gsj01001]
    114418618
Enzymes [BR:gsj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114418618
Protein kinases [BR:gsj01001]
 Serine/threonine kinases: TKL group
  IRAK family
   114418618
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH Haspin_kinase Pkinase_fungal PIP49_C
Motif
Other DBs
NCBI-GeneID: 114418618
NCBI-ProteinID: XP_028239856
Position
7
AA seq 387 aa AA seqDB search
MSFLRRLCPCLHKGGAAFHDGDDDDVDRNHPGDSFDLIFGLHTLQLATNFFSDINRLGHG
GFGPVFRGLMPNGQEVAVKKLSLESRQGDREFTNEVRLLLRIQHKNLVTLLGCCAEGPEK
MLVYEYLPNKSLDRFLFDKRRSSSLDWATRFRIVTGVARGLLYLHEEAPERIIHRDIKAS
NILLDEKLNPKISDFGLARLFPGEDTYMQTFRISGTHGYMAPEYALHGYLSVKTDVFSYG
VLLLEIVSGRKNHDMQLGSEKADLLSYAWSLYQGRKIMDLIDPTLGRYNGDEAAMCIQLG
LLCCQASIIERPDMNNVNLMLSSDSFTLPRPGKPGIQGRAGRWNTTSTSALTNTNASSAT
RVSGGSGSFVEDYSRNSISTSSFDEGR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcctccgcaggttgtgcccctgtttgcacaagggcggcgcagccttccacgac
ggcgatgacgacgacgtagatcgcaaccaccccggcgactccttcgacctaatcttcggc
ctccacactctccaactcgccaccaacttcttctccgacatcaaccggctaggtcatgga
ggctttggtcctgttttcaggggattgatgccaaatggtcaagaagtggcggttaagaag
ctgtcattggaatctaggcaaggagatagagaattcaccaatgaagtcaggctattactc
agaattcagcacaagaacttggttacattactgggttgttgtgcagaagggcctgaaaag
atgcttgtatatgagtatctgcctaacaaaagccttgatcgctttctgtttgataagaga
aggtcttcatctttggactgggcaacgcgatttagaatagttacaggtgtggcaagagga
cttctctacctgcatgaagaggccccggaaagaattattcacagggacattaaagctagt
aacatattgctggatgagaaattaaatccgaaaatttcggactttggtttggcaaggttg
tttcctggggaggacacttatatgcagacatttaggatttctggtacacatggttacatg
gcccctgaatatgcattgcatggatatctgtctgtgaagacagatgttttcagttatgga
gtcctgctgttggaaatagttagtgggagaaaaaaccatgatatgcagcttggttcagaa
aaggcagatctcctgagctatgcgtggtcgctttatcaaggaaggaagataatggactta
attgacccaacccttggtagatataatggtgatgaggcagcaatgtgcattcagctaggt
ttgttgtgctgtcaagcaagcataattgaaagacctgacatgaataatgttaatctcatg
ctctcaagtgattccttcactttgccaagaccaggaaaaccaggaattcaaggtcgtgca
ggacgttggaatacaacctcaacttctgctttgaccaataccaatgctagtagtgctacc
agggtctcaggtggtagtggtagttttgtagaggattattctagaaattctatatccacc
tcttcttttgatgaaggaagatga

DBGET integrated database retrieval system