KEGG   Glycine soja (wild soybean): 114418987Help
Entry
114418987         CDS       T06057                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj00480  Glutathione metabolism
gsj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    114418987
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gsj02000]
    114418987
Enzymes [BR:gsj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     114418987
Transporters [BR:gsj02000]
 Other transporters
  Pores ion channels [TC:1]
   114418987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_2 GST_C_3 Bot1p Endopep_inhib
Motif
Other DBs
NCBI-GeneID: 114418987
NCBI-ProteinID: XP_028240361
Position
7
AA seq 222 aa AA seqDB search
MASSQEEVILLGVIGSPFLHRVQIALKLKGVEYKYLEDDLNNKSDLLLKYNPVYKMIPVF
VHNEKPISESLVIVEYIDDTWKNNPILPSDPYHRALARFWAKFIDDKCVAPAAKSVFIVD
EKEKEKAKEELFEALNYLENELKGKFFGGDEFGFVDIAAVIIPIIQEIAGLQLFPSEKFP
KLSKWSQDFYNHPLVNQVMPPKDQLFAYFKARAQSLAAKTKN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaagtcaggaagaggtgatccttttgggggttattggaagcccatttctgcac
agggtgcagattgctctcaaattgaagggagttgaatacaaatatttggaagatgatttg
aacaacaagagtgatttgctcctcaagtataacccagtttataaaatgattccagtgttt
gttcacaatgaaaagcccatatccgagtcccttgtgattgttgagtacatcgatgacaca
tggaaaaacaaccccatcttgccttctgatccttaccatagagccttggctcgtttctgg
gccaagttcattgatgacaagtgcgtggctccagcagcgaaatctgtttttattgttgat
gagaaagagaaagagaaggcaaaagaagaattatttgaggctctgaattatcttgagaat
gagttgaagggaaagttttttggtggagatgagtttggctttgtggatattgctgctgtg
atcatacctataattcaagagatagcagggttgcaattgttcccaagtgagaaattccca
aagctctccaaatggagccaagacttttacaaccatccacttgttaaccaagttatgcct
cctaaggaccaactttttgcctatttcaaggctcgggctcaaagcctcgctgctaaaaca
aagaattaa

DBGET integrated database retrieval system