KEGG   Glycine soja (wild soybean): 114424498Help
Entry
114424498         CDS       T06057                                 

Definition
(RefSeq) receptor-like cytosolic serine/threonine-protein kinase RBK1
Organism
gsj  Glycine soja (wild soybean)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 114424498
NCBI-ProteinID: XP_028247160
Position
8
AA seq 477 aa AA seqDB search
MERLERRSKKEEVKEKKKSRKFELTLMLGGQNQKKEVVDDDDVSVSPRDVFGVPILGMDS
DSTGSSNYGGPGSPGLGQKHSQQWRAMIDVLRFKSVRRFSTIPLLAASYEISRKSLRNKL
ARILPANEEDDDLNLGIDIDDISTKPSWRNFSYADLAAATDDFSPVNLLGKGGHAEVYKG
CLADGQVVAVKRLMRNEKEIEGKAGDFLTELGIIAHINHPNATRLIGFGIDNGLYFVLQL
APHGSLSSLLFGSECLEWKIRFKVAVGVAKGLQYLHHDCPRRIIHRDIKASNILLNQNNE
AEISDFGLAKWLPDKWAHHVVFPIEGTFGYLAPEYFMHGIVDEKTDVFAFGVLLLELITG
RRAVDSNSRESLVIWAKPLLEAKLIEQMVDPRLELKYDLAEMKCAMVTASMCIHHMSSKR
PYMNQVVQLLKGEEVPIELTQNSSAPRSHLIDACDLEDYTCSNYLTDLNRHKQLLME
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggagagattagagaggaggagcaagaaggaggaagtgaaagaaaagaaaaagagccga
aagtttgagttaacgttgatgttgggtggccagaaccaaaagaaagaggtggttgacgac
gacgacgtatcggtatcgccgagggatgtgtttggggttcctattttagggatggattca
gatagcacggggagcagcaactacggcgggccggggtcgccaggccttggccagaagcat
agccagcagtggagggcgatgatcgatgttttgaggttcaagtccgttaggagattctca
acgatcccgttgcttgcagcgagctacgagatctcgaggaagagcctaaggaacaagctg
gcgcgtattctacccgcgaatgaagaagacgatgatttgaatcttggaattgacattgat
gacatttccaccaagccttcttggaggaacttcagttatgctgaccttgccgctgccaca
gacgatttcagccctgtgaacttgcttggaaaaggtggtcatgctgaagtctacaaagga
tgcttagcagatggtcaagtcgtagccgtaaagaggctaatgaggaatgaaaaagaaatt
gagggcaaagctggtgatttcttgacagagcttggaatcatcgctcacattaaccatccc
aatgcaacacgcttgattgggtttgggatcgacaatggtctctactttgttctacaattg
gccccacatggcagcctttcctctttgctctttggttctgaatgtttagagtggaagata
aggtttaaagtagctgttggggtggcaaaagggttgcagtatctccaccacgattgccca
agaagaatcattcacagagacatcaaagcctcaaatattttactcaaccaaaataatgaa
gctgagatttcagattttggattggcaaagtggctcccagataagtgggcccaccatgtt
gtcttcccaattgaaggcacatttgggtatttggctccagaatactttatgcatggaatt
gtggatgagaaaactgatgtttttgcatttggggttttgttactggaactcataacaggt
cgtcgtgcagttgattcaaatagtagggaaagtcttgtgatctgggccaaacccctgctg
gaagcaaagttgatcgaacaaatggtagaccccagattagaactgaaatatgatctggca
gaaatgaagtgtgccatggtaacggcttccatgtgtatccatcacatgtcctctaagcga
ccatacatgaatcaggttgtgcagttactgaaaggggaagaggtgcctattgaactcaca
caaaattcatcagctccaagatcacacttgatagatgcatgtgacttggaagattatact
tgctctaattatttgactgacctcaatcgccacaagcaattactcatggagtga

DBGET integrated database retrieval system