KEGG   Glycine soja (wild soybean): 114424569Help
Entry
114424569         CDS       T06057                                 

Definition
(RefSeq) probably inactive leucine-rich repeat receptor-like protein kinase At5g48380
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
gsj  Glycine soja (wild soybean)
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gsj01001]
    114424569
Enzymes [BR:gsj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114424569
Protein kinases [BR:gsj01001]
 Serine/threonine kinases: TKL group
  IRAK family
   114424569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase LRR_8 LRRNT_2 LRR_4 LRR_6 LRR_1 MMM1
Motif
Other DBs
NCBI-GeneID: 114424569
NCBI-ProteinID: XP_028247224
Position
8
AA seq 612 aa AA seqDB search
MVFQIKRDILMHAFWCSSLLSFCMVVVAHGVESDISCLKSIKNTLEDPHNKLSSWKNFNN
KTNGFICDFVGVECWHPGENKVLHLNLTNMGLKGEFPRDLRDCPSLTSLNLSHNELTGPI
PSDISTLLPYATSIDLSNNKFNGEIPPSLGNCSYLTSLRLDNNMLSGQIPQQLEQLPRLR
KISFVNNNLSGPVPLFQPGLTCVDCYANNRELCGGPLPPCGSSDDFTETFKKGLAIGYAF
SVTSVIVIYISYFAPWEQSESKHKTNYKAKEFRKYICSIAGRKTPTEPHTEQELQPLQLQ
EKAIKEISVVTDRMKSTMRLNEVRDATDCFSIDNAIGMGKIGIMYKGRLPNGWNLAIKRL
FDSKLFKRQFLLEIRILGKYRHKNIVPLLGFCVEGKERILVYQYMSNGRLSKWLHPLESE
VTLKWPQRIKIALGVARGLSWLHHICDLHVVHRNISSGCVLLDKNFEPKISNFGNAKFIN
PNIEDSASTTFYVSDGKKDVYDFGSLLFELITGKTLKELSCSFNTTNLSGNPSNFYNAIE
ESLIGEGFENEVYTLIKVACKCVKPFPDERPTMLEVYNYMIDIWGERHRISDGSDTLNVS
SSSTSVDEIVEL
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggtttttcaaataaaaagggatattctcatgcatgccttctggtgttcttccttactc
agtttctgcatggtagtagtagctcatggcgttgaaagcgatatatcctgcttaaaatca
attaagaacaccttagaagacccacataacaaattatcaagttggaagaacttcaacaac
aaaaccaacggtttcatatgcgatttcgttggcgttgaatgctggcaccctggcgagaat
aaagtgctacatctcaacctcacaaacatgggtctgaagggtgagtttccacgtgatctt
cgggattgcccttcattgacatccttaaacctttcacacaacgagctcacaggacccatc
ccatctgatatatccacattactcccttatgctacttccattgacctatcaaataacaag
tttaatggggaaattccaccaagtttgggtaactgcagttacctgacttctcttagactt
gataacaacatgttaagtggtcaaatcccacaacaacttgaacagcttcctaggcttaga
aaaatctcttttgtcaacaataatttatcagggccggttcctctgttccaacctgggtta
acttgtgttgattgttatgccaataacagagaactttgtggagggcctttgccaccatgt
gggtcaagcgatgatttcactgaaacattcaagaagggccttgctattggctatgctttt
tcggtgacttctgttattgtcatttatatctcctactttgcaccttgggaacaatcagaa
tcaaagcataaaacaaattacaaggctaaagaattccgcaaatatatttgctccatcgca
gggaggaagacaccaactgaacctcataccgaacaagaattgcaacctctgcagttgcaa
gagaaagctatcaaagagatttctgtagtgacagacagaatgaagtcaacaatgaggctc
aacgaagtcagagatgcaactgattgcttttccatagacaatgccattgggatggggaaa
attggaataatgtacaagggaaggttaccaaatggttggaaccttgcgatcaagagacta
ttcgattctaaactatttaagaggcaatttcttttagaaataagaattttgggcaagtac
agacacaaaaatatagttcccctgcttgggttctgtgtggaaggaaaggaaaggattctg
gtataccaatacatgtcaaatggaaggctttcaaaatggttgcatcctttagaaagtgaa
gttacattgaaatggcctcagaggatcaaaatagctcttggggtagcaagaggcttatcc
tggctccatcatatctgtgatttgcatgttgtgcatcgtaatataagttcgggatgtgtc
ttgctagataagaattttgaacccaaaatatccaattttggaaatgccaagtttatcaat
cccaacattgaggacagtgcaagcacaacattttatgtaagcgacgggaagaaggatgtc
tatgactttggtagtttgctttttgagctaatcacagggaaaacattgaaggaattatca
tgttcattcaatactactaacctatctggtaacccttctaatttttataatgcaattgag
gaatctctaattggggaaggttttgaaaatgaggtctacactctcatcaaagtagcatgt
aagtgtgttaagcctttcccagatgaaagaccaacgatgcttgaagtttataactatatg
atcgatatatggggagagcgacatagaataagtgatggttctgacacactcaacgtatct
agttcttctactagtgtagatgaaattgttgagctatga

DBGET integrated database retrieval system