KEGG   Glycine soja (wild soybean): 17675602Help
Entry
17675602          CDS       T06057                                 

Gene name
rbcL, W848_p081
Definition
(RefSeq) ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj00630  Glyoxylate and dicarboxylate metabolism
gsj00710  Carbon fixation in photosynthetic organisms
gsj01100  Metabolic pathways
gsj01110  Biosynthesis of secondary metabolites
gsj01200  Carbon metabolism
Module
gsj_M00165  Reductive pentose phosphate cycle (Calvin cycle)
gsj_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
gsj_M00532  Photorespiration
gsj_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    17675602 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    17675602 (rbcL)
Enzymes [BR:gsj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     17675602 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 17675602
NCBI-ProteinID: YP_008816229
UniProt: R9RPL1
Position
CP
AA seq 475 aa AA seqDB search
MSPQTETKASVGFKAGVKDYKLTYYTPDYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYGLEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPTAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIFKSQAETGEIKGHYL
NATAGTCEEMMKRAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRLSGGDHVHAGTVVGKLEGEREITLGFVDLLRDDFVEKDRSR
GIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAREGNEIIREASKWSPELAAACEVWKEIKFEFEAMDTL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttgggttcaaagctggtgttaaagattat
aaattgacttattatactcctgactatgaaaccaaagatactgatatcttggcagcattc
cgagtaactcctcaaccaggagttccgcctgaagaagcaggtgccgcggtagccgccgaa
tcttctactggtacatggacaactgtgtggaccgatgggcttaccagtcttgatcgttac
aaagggcgatgctacggccttgaacctgttgctggggaagaaaatcaatatattgcttat
gtagcttatcccttagacctttttgaagaaggttctgttactaacatgtttacttccatt
gtcggtaatgtatttgggttcaaggccctgcgtgctctacgtctggaggatttgcgaatc
cctactgcttatattaaaactttccaaggtccgcctcatggcatccaagttgagagagat
aaattgaacaagtatggtcgtcccctattaggatgtactattaaacctaaattggggtta
tccgctaagaattatggtagagctgtttatgaatgtcttcgtgggggacttgattttacc
aaagatgatgaaaatgtgaattcccaaccatttatgcgttggagagaccgtttcttattt
tgtgccgaagccatttttaaatcacaggctgaaacaggtgaaatcaaagggcattacttg
aatgcaactgcgggtacatgcgaagaaatgatgaaaagagctgtatttgccagagaatta
ggcgttcctatcgtaatgcatgattatttaacggggggattcactgcaaatactagcttg
gctcattattgccgagataatggtctacttcttcatatacaccgtgcaatgcatgcagtt
atcgacagacaaaagaatcatggtatgcactttcgtgtactagctaaagcattacgtttg
tctggtggagatcatgttcacgccggtaccgtagtaggtaaacttgaaggggaaagagaa
atcactttaggttttgttgatttactacgtgatgattttgttgaaaaagatcgaagtcgc
ggtatttatttcactcaggattgggtttctctaccaggtgttttgcctgtagcttcggga
ggtattcacgtttggcatatgcctgctctgaccgagatctttggggatgattctgtactc
caatttggcggaggaactttaggacacccttggggaaatgcaccaggtgctgtagctaat
cgagtagctcttgaagcatgtgtgcaggctcgaaatgaaggacgcgatcttgctcgtgaa
ggtaatgaaattatccgtgaggctagcaaatggagtcctgaattagctgctgcttgtgaa
gtatggaaggagatcaaatttgaattcgaagcaatggatactttgtaa

DBGET integrated database retrieval system