KEGG   Geobacter sulfurreducens KN400: KN400_0357Help
Entry
KN400_0357        CDS       T01940                                 

Definition
(GenBank) phosphate/sulfate transporter family membrane protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
gsk  Geobacter sulfurreducens KN400
Brite
KEGG Orthology (KO) [BR:gsk00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    KN400_0357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: ADI83220
Position
386483..387484
Genome map
AA seq 333 aa AA seqDB search
MLDTTLIMLVLVIGAALAFDYINGFHDTANAIATCVSTRALSVRSAIVMAAVLNFAGAMI
STKVAATIGKGIVDAGNVTQMVVLAGVLGAIIWDLVTWYYGLPSSSSHAIIGGIMGAVIA
HAGTTALHWGGLKKIILSLILSPVIGTLLGFIVMVVMLWSFKSTSPHSINKHFRRLQVLS
AAFMAFSHGTADAQKSMGVITMALVSYGTLTTFDVPTWVKIACAVAMGLGTAAGGWRIIK
TVGKDFVKLQPVHGFCVETASAGVILGASSIGMPVSTTHVITSTILGVGLSKRITAVNWN
VAYRILWAWVLTIPASAIMSYVSYMVLNPFLGK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacactacgctgatcatgctcgtcctggttatcggggcggcacttgcgttcgac
tacatcaacggatttcacgacacggccaatgcgattgccacctgcgtttcgactcgggca
ctgtcggtccggtcggccattgtcatggcggcagtgctcaactttgcgggagcaatgatt
tcgaccaaggtggccgccacgatcggcaaggggatcgtggacgccggcaacgtgacgcag
atggtggtgctcgccggggtcttgggtgcgattatctgggacctcgtcacgtggtactac
gggcttccctcttcgtcgtcacacgccatcatcggcggaatcatgggcgcggtcatcgcc
cacgccggcacgacggccctccattggggcgggctgaaaaagatcatcctctcgctcatc
ctttctcctgtcattggaacgctcctcgggttcatcgtcatggtggtcatgctctggagc
ttcaagagcacctcgccccactccataaacaagcacttccgtcgtctgcaagtcctttcg
gccgcattcatggccttttcccacggcaccgccgacgcccagaagtccatgggcgtcatc
accatggcgctggtgagttatggaaccctcaccaccttcgatgttccaacctgggtcaag
attgcctgtgccgtggccatgggcctcggcaccgcggccggcggctggcggatcatcaag
accgtggggaaggatttcgtcaagctgcagccggtccatggcttctgcgtcgaaaccgct
tcggccggcgtcatcctgggggcgtcctccatcggcatgccggtcagcactacccacgtc
atcacctccactatcctcggcgtggggctctccaagcggatcacggccgtgaactggaac
gtggcctaccgtatcctctgggcctgggtcctgaccatccccgcttcggcgatcatgtcc
tatgtttcatacatggttttgaacccgttcctcggcaaataa

DBGET integrated database retrieval system