KEGG   Geobacter sulfurreducens KN400: KN400_0398
Entry
KN400_0398        CDS       T01940                                 

Gene name
tssK
Definition
(GenBank) type VI secretion system protein TssK
  KO
K11893  type VI secretion system protein ImpJ
Organism
gsk  Geobacter sulfurreducens KN400
Brite
KEGG Orthology (KO) [BR:gsk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:gsk02044]
    KN400_0398 (tssK)
Secretion system [BR:gsk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KN400_0398 (tssK)
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: ADI83261
Position
423530..424921
AA seq 463 aa
MNAHPPLYWHQGLFLQPHHFQLQDLSVQGRLAPLFRHLHPHFWGAGELEIEASALGTRVF
SILSGEFLFPDGTWAVIGENALCEPRSFDDSWIEGDRPLPVYVGVRKWSGDRENVTVTER
LENLGGITTRFAAAADPEEMRDLHAGGPAGQVKRLRHVLKILWDSERDQLGDWHLIPVAR
LERFGADVRLSGRFIPPCLSLEASEPLFRIVREIRDQVAARARQLEEHKKQRGIQNAGFG
SRDMVYLLALRSLNRHVPLLFHLTEARQVHPWDVYGALRQLIGELSSFSERVSALGKLDD
GVRLLPPYDHRALGERFFVARDLIARLLDEITAGPDYVIRLTHDGTFFSADLKPGIFETG
SRYYLALRTTTEPAAFLPSLEAAAKLSARNHLPVLAARALPGIGLSHLPVPPQELPRRAD
THYFAVDTAGDQWPLVEREHALALHWTGAPADLEVELMVVAKG
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgaacgcccatccccccctttactggcaccaggggctctttctccagccccatcacttt
cagctccaggacctgtcggtccaggggcgtctcgcccccctgttccgccatctccacccc
cacttctggggggcgggtgagctggagatcgaggccagcgctctcggcacccgggtcttc
agcatcctttccggcgagttccttttccccgacggcacctgggcggtcatcggcgagaac
gccctctgcgagccgcgctccttcgacgactcctggatcgaaggggatcgtcccctgccg
gtctacgtgggagtgcgcaagtggagcggggatagagagaacgtgaccgtcaccgaacgg
ctcgaaaacctcggcgggatcaccacccgcttcgccgccgcggcagatccggaggagatg
cgcgatctccacgccggcggcccggcaggtcaggtgaagcggctgcgccatgtgctgaaa
atcctctgggacagcgagcgggaccaactgggcgactggcacctgatcccggtggcgcgg
ctggagcgcttcggggccgacgtgcggctctccggccgcttcatccccccttgcctctcc
ctcgaagcgagcgagcccctctttcgcatcgtccgggagatccgggaccaggtggcggcc
cgcgccagacagctggaggagcacaagaagcagcgcggcatccagaacgccgggttcggc
tctcgggacatggtctacctcctggcgctccgttctctcaaccggcatgtgcctctcctc
ttccacctgaccgaggcgcggcaggtccacccgtgggacgtctacggggccctgcgccag
ctcatcggcgaactctcctccttctccgagcgggtctcggcccttggcaaactggacgac
ggcgtccggcttctccctccctatgatcaccgggcactcggggagcgctttttcgtggcc
cgtgacctcatcgcccgacttctggacgagatcaccgccggtcccgattacgtgatccgc
ctcacccacgacggcaccttcttcagcgccgacctgaagccgggcatctttgaaaccggc
agccgctattacctggccctgcggaccaccacggagccggctgcgttcctcccgtccctt
gaagccgccgccaagctcagcgcccggaaccacctgccggtcctggccgcccgcgccctc
cccggcatcggcctgagccacctgccggtcccgccccaggagctgccgcgccgcgccgac
acccactacttcgccgttgatactgccggtgaccaatggcccctggtggagcgggaacac
gcccttgccctccactggaccggcgccccggccgatctggaggtggagctgatggtggtg
gccaaggggtag

DBGET integrated database retrieval system