KEGG   Geobacter sulfurreducens KN400: KN400_1245Help
Entry
KN400_1245        CDS       T01940                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
gsk00240  Pyrimidine metabolism
gsk00250  Alanine, aspartate and glutamate metabolism
gsk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    KN400_1245 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KN400_1245 (pyrB)
Enzymes [BR:gsk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     KN400_1245 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ADI84106
Position
1356516..1357451
Genome map
AA seq 311 aa AA seqDB search
MGFKHKDIIGLQDLTREEIQLLLDTADNMKEINSRDIKKVPTLRGKTVVNVFYEASTRTR
TSFEIAAKRLSADTINISASTSSVTKGETLSDTARNILAMKPDIIVMRHAASGAHHYLAQ
RVSCSVINAGDGAHEHPSQGLLDMLTMRQKFGTIEGLTVAIVGDITHSRVARSDIFGLTK
MGAHVRLAGPPTMMPPGIERLGNVTVCRDMREAIEGVDVVMMLRIQLERQGKTLLPTLRE
YARYYGLNPQNLKLAKPGAMVMHPGPINRGVELSSYVADSDQSAILTQVENGVAVRMAML
YHVSGGELATE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggggttcaagcataaggatatcatcgggttgcaggatctgacccgggaggaaattcag
ctcctcctcgacacggccgacaacatgaaggagatcaactcccgcgacatcaagaaggtg
ccgaccctgcgcggcaagaccgtggtgaacgtcttctacgaggcatccacccggacccgg
acctccttcgagattgcggccaagcgcctttccgccgatacgatcaacatctcggcctcc
accagttccgtgaccaagggggagaccctttccgatacggcccgaaacatcctggccatg
aagcccgacatcatcgtcatgcgccacgccgcttcgggcgctcaccactatctggcccag
cgggtctcctgctcggtgatcaatgccggcgacggcgcccatgagcacccctcccagggg
cttctggacatgctgaccatgcgccagaagttcggaacgatcgaagggctcacggtggcc
atcgtgggtgacatcacccacagccgcgtggcccgctccgacatcttcggcctcactaaa
atgggggcgcatgtccgtctcgccggcccaccgaccatgatgcccccgggcatcgagcgc
ctcggcaacgtgaccgtctgccgcgacatgcgtgaggccatcgagggggtcgatgtggtg
atgatgctccgcatccagcttgagcgccagggcaagaccctgttgccgaccctgcgtgag
tatgcccgctactacggcctcaatccccagaacctgaagttggccaagcccggcgccatg
gtcatgcacccgggccccatcaaccggggggtggagctttcctcctacgtggcggacagc
gaccagtccgcgattctcacccaggtcgagaacggcgtggccgtgaggatggcgatgttg
taccacgtgagcggcggtgagctggccaccgagtga

DBGET integrated database retrieval system