KEGG   Geobacter sulfurreducens KN400: KN400_1726Help
Entry
KN400_1726        CDS       T01940                                 

Definition
(GenBank) ROK domain transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
gsk00010  Glycolysis / Gluconeogenesis
gsk00052  Galactose metabolism
gsk00500  Starch and sucrose metabolism
gsk00520  Amino sugar and nucleotide sugar metabolism
gsk00521  Streptomycin biosynthesis
gsk01100  Metabolic pathways
gsk01110  Biosynthesis of secondary metabolites
gsk01120  Microbial metabolism in diverse environments
gsk01130  Biosynthesis of antibiotics
gsk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KN400_1726
   00052 Galactose metabolism
    KN400_1726
   00500 Starch and sucrose metabolism
    KN400_1726
   00520 Amino sugar and nucleotide sugar metabolism
    KN400_1726
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    KN400_1726
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    KN400_1726
Enzymes [BR:gsk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     KN400_1726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase FGGY_N
Motif
Other DBs
NCBI-ProteinID: ADI84538
Position
1833845..1834801
Genome map
AA seq 318 aa AA seqDB search
MIRPAFIGMDIGGTNLRMGLVDEAGTILFRFRQKTDIHEGRAAFYEKLAEGIGILKEHAE
QAGFRIVAVGAGVPGLVANDGHIHVSVNLPAIDSINLRHDLERISGLPATVANDVNATAY
GEKSFGAGREFDSFLMVTLGTGVGGGLILNGRLWTGIDGVAGEFGHVTVEPQGTSCPCGN
RGCLEQYASATAIASAAREAMMTGRYVPADGSAIPLTTQDLARLAREGDGAAATFFAEAG
RYLGMATASLANVLNLEALIVGGGVAASFDLIRSSIEREVRARAFPIPAQRLVVVRGALG
DDGGLLGSAALARDEFDI
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcccggcgttcatcggcatggatatcggtgggaccaatctgcggatgggactc
gtcgacgaggcgggaacgatccttttccgcttcaggcagaaaaccgatattcatgagggg
agagccgccttttacgaaaagctcgccgaggggataggcattctcaaagagcacgcagag
caggcgggattccgcatcgtggcagttggtgccggcgttccggggcttgtggcaaatgac
ggacatatccacgtatcggtgaatcttccggccattgacagcatcaacctccgccatgac
ctggaacgcatcagtggtctgccggcgacggtggccaacgatgtcaacgccaccgcgtac
ggcgagaaatccttcggtgccggacgcgagttcgactcgttcctgatggttacactcggc
accggcgtcggaggagggctcatcctgaacgggcggctgtggaccggaatcgacggcgta
gccggcgagttcggtcatgtgacggtcgagccccaggggacgtcctgtccctgcggcaac
cggggttgtcttgagcaatatgcctctgccacggccatagcctcagccgcgcgagaggcc
atgatgacggggcgatacgtaccggctgacgggtctgcgatacctctcactacccaggat
ctggcccgtctcgcccgggaaggggatggtgcggcggcgacatttttcgccgaggcggga
cgttatctgggcatggcaacggcatcactggccaacgtactcaatctggaagcactgatc
gttggtgggggcgtcgctgcaagctttgatctgatcaggagttccatagagcgagaggtt
cgtgcccgagctttcccgattccggcccagcggctggtggtggtccgtggcgcattgggc
gacgacggaggactcctgggaagcgctgcgctggcccgtgatgagttcgacatctaa

DBGET integrated database retrieval system