KEGG   Geobacter sulfurreducens KN400: KN400_1934Help
Entry
KN400_1934        CDS       T01940                                 

Definition
(GenBank) phosphatidylserine decarboxylase, putative
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
gsk00564  Glycerophospholipid metabolism
gsk01100  Metabolic pathways
gsk01110  Biosynthesis of secondary metabolites
Module
gsk_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:gsk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    KN400_1934
Enzymes [BR:gsk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     KN400_1934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ADI84746
Position
complement(2057996..2058652)
Genome map
AA seq 218 aa AA seqDB search
MRNENTPIAVEGYPFIAIAGVLTLILAAVSWHAPVVWAGTAFFLTVTLFVAFFFRNPERI
TPGNENAVVAPADGVVIYLGPAREEHLGVETTKISIFMSVFNVHINRAPVSGTVLDTFYV
KGKFLDVRDDRATFENEQAGLVIETARGLRLAVVQVAGLIARRIVCYAGKGDRLTRGGRY
GLIRFGSRLDIYLPTTTEVKVALGEKTVAGETVLGILP
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcggaatgaaaacacccccatagcagtcgaggggtatccctttatcgccattgccggc
gttctgacactcatcctagccgccgtatcctggcatgctcccgttgtctgggcggggacg
gctttctttctgacagtcacgctgttcgttgcctttttcttccgcaatcccgaacggata
acccctggcaacgagaatgccgtagttgcacccgcagacggtgttgtcatctatctcgga
cctgcccgcgaagagcacctgggagtggaaaccacgaaaatcagcatcttcatgtcggtg
ttcaacgtccacatcaaccgtgcaccggtgagtggcacggtgctcgacaccttctacgtg
aagggaaaatttctcgatgtgcgcgacgatcgcgcgaccttcgagaacgagcaggcgggg
ctggtcattgagacggcccgtggccttcgactggctgtcgtgcaggtggcgggtctcatt
gcccggcgtatcgtttgctacgcagggaagggggaccggctcaccaggggggggcgttat
ggtctgatccggttcggttcgcgtctcgatatctatctgccgaccactaccgaggtcaag
gtcgctctaggcgagaagacggtagccggtgaaaccgtcctggggattctgccatga

DBGET integrated database retrieval system