KEGG   Geobacter sulfurreducens KN400: KN400_2104Help
Entry
KN400_2104        CDS       T01940                                 

Definition
(GenBank) nucleoside diphosphate-sugar dehydratase, putative
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
gsk00521  Streptomycin biosynthesis
gsk00523  Polyketide sugar unit biosynthesis
gsk01130  Biosynthesis of antibiotics
Module
gsk_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    KN400_2104
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    KN400_2104
Enzymes [BR:gsk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     KN400_2104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Cupin_2
Motif
Other DBs
NCBI-ProteinID: ADI84916
Position
complement(2258614..2259102)
Genome map
AA seq 162 aa AA seqDB search
MSVSPEFTRGKIHDVVVKPLGKFLDERGWLAELFRSDETDPATMPVMAYVSMTRPGIARG
PHEHVDQTDWFCFIGPSNFKVYLWDSRPDSPTHGVKQTLFAGIDAPMSVIVPPGVVHAYK
NVGGVDGIVFNAPNRLYAGEGKSSPVDEIRHEDVAGSPFILD
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttagtcccgagttcacccgcggcaagatccacgacgtggtggtgaagcccctt
ggcaagttcctggacgagcggggctggctcgccgaactgttccgcagcgacgaaaccgat
cccgcgaccatgccggtcatggcctacgtttccatgacccggccgggcattgcccggggg
cctcacgagcacgtggaccagaccgactggttctgctttatcggtccgtccaatttcaaa
gtctatctctgggactcccggcccgactcgccgacccacggcgtgaagcagaccctgttc
gcggggatcgacgcgccaatgtccgttatcgtgccgccgggcgtcgtccatgcctacaag
aatgtcggcggtgttgacggcattgtcttcaacgcgcccaacaggctgtatgccggagag
ggaaaatcctcaccggtagatgagatccgccacgaggacgtggccgggtcccccttcatc
ctggattga

DBGET integrated database retrieval system