KEGG   Geobacter sulfurreducens KN400: KN400_3111
Entry
KN400_3111        CDS       T01940                                 

Gene name
tssB
Definition
(GenBank) type VI secretion system needle sheath protein TssB
  KO
K11901  type VI secretion system protein ImpB
Organism
gsk  Geobacter sulfurreducens KN400
Brite
KEGG Orthology (KO) [BR:gsk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:gsk02044]
    KN400_3111 (tssB)
Secretion system [BR:gsk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KN400_3111 (tssB)
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ADI85923
Position
3375185..3375670
AA seq 161 aa
MSNEASVAPKERVNIVYRPADGEGREEVELPLKILVLGDFTGQPDERPVEKRDPVPVDKE
NFSEVMKAQRIMLNIAVSNRLYDAPDEELPVKLKMESLRDFGPEAIVEQVPEMKRLLELR
EALRALKAPLSNIPDFRRKIQELVTDDAARAKLLAEIGIEG
NT seq 486 nt   +upstreamnt  +downstreamnt
atgtcgaatgaagcatccgtagcaccgaaggaacgggtgaacatcgtctaccgtcccgcc
gatggcgaagggcgcgaggaagtggagcttccccttaaaatcctggtgttaggggacttt
accgggcaaccggacgagcggcccgtggagaagcgggacccggtgccagtggacaaagaa
aacttcagcgaggtcatgaaggcccagagaatcatgctgaacatcgccgtctccaaccgg
ctttacgatgcacccgacgaggagctgccggtgaagctgaaaatggaatccctgagagat
ttcggcccggaggccattgtggagcaggtcccggagatgaaacgcctgttggagttgcgc
gaggcactgcgggcgctgaaggctcccctctccaacattccggacttccggagaaaaatt
caggaactggtcactgacgatgccgcccgcgccaagctgctggctgaaatagggatcgaa
gggtaa

DBGET integrated database retrieval system