KEGG   Geobacter sulfurreducens KN400: KN400_3113Help
Entry
KN400_3113        CDS       T01940                                 

Gene name
tssD
Definition
(GenBank) type VI secretion system needle tube protein TssD
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
gsk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:gsk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KN400_3113 (tssD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:gsk02044]
    KN400_3113 (tssD)
Secretion system [BR:gsk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KN400_3113 (tssD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP DUF5521
Motif
Other DBs
NCBI-ProteinID: ADI85925
Position
3377247..3377732
Genome map
AA seq 161 aa AA seqDB search
MAMPAHMTLTGEKQGKIDGSCELQGRENTIQLYEMKHDIHMPRNPHDGLPTGKRVHGPLS
IVKMFDKSSPKLYQALCTGEHMKNVQIKWYRINKQGLEEHYFTTTLEDAIVVEMKPYMPM
TLLPANEPYGHMEEVAFSYKKIKWTWEPNGIEAEDSWSVPK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgcccgcccacatgaccctgactggagaaaaacagggaaagatcgacggttcc
tgcgaactgcaggggcgcgaaaacactatccagctttacgaaatgaagcacgacatccac
atgccgcgcaatccccatgacggcctgcccaccggcaagcgcgtccatggccccctgtcg
atcgtcaagatgttcgacaagagttcgccgaaactctatcaggccctctgcaccggagag
cacatgaaaaacgtgcagatcaagtggtaccgtatcaacaaacaagggctggaagagcac
tatttcaccaccacccttgaggatgccatcgtggtcgagatgaaaccctacatgcccatg
acgctccttcctgcgaacgagccctacggccatatggaagaggtggcattctcctacaag
aagatcaagtggacctgggagcccaacggtatcgaggctgaggattcctggagcgtgccc
aagtag

DBGET integrated database retrieval system