KEGG   Galdieria sulphuraria: Gasu_03270Help
Entry
Gasu_03270        CDS       T02926                                 

Definition
(RefSeq) alanine transaminase
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
gsl  Galdieria sulphuraria
Pathway
gsl00220  Arginine biosynthesis
gsl00250  Alanine, aspartate and glutamate metabolism
gsl00710  Carbon fixation in photosynthetic organisms
gsl01100  Metabolic pathways
gsl01200  Carbon metabolism
gsl01210  2-Oxocarboxylic acid metabolism
gsl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gsl00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Gasu_03270
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gasu_03270
   00220 Arginine biosynthesis
    Gasu_03270
Enzymes [BR:gsl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Gasu_03270
Amino acid related enzymes [BR:gsl01007]
 Aminotransferase (transaminase)
  Class I
   Gasu_03270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 17091123
NCBI-ProteinID: XP_005709075
UniProt: M2X7P2
Position
Unknown
AA seq 513 aa AA seqDB search
MKSLRFYSSLFRRPETQVTQYFKRFCTVSSTYVSNSYEKVLKGGGISDSVREAQYAVRGE
VPTRALQLEEELKHNKQRPYDHIIFCNVGNPQSLENPPITYVRQVLALCDFPELLNSNLF
PADAKEHAKRILISAGKGGSGAYSNSGGVSCIREDIVDFIQRRDGYESSVNNVFLTNGAS
DGIALIMKLLVSSSNSGVMVPVPEYPLYSALLSLLGAKPVRYYLNEDRNWSIELSELERA
YESSKKAGISISGIVLISPGNPTGQVLEKSNLEEIIDFAYRRRLVVLADEVYQENVYTKG
KKFVSVKKVLRDMPGKYQDVELASFHSASKGFYGECGRRGGYLEVANFNEEALEQLYKLA
SINLCANLNGQIAMSCITRHPTQGMPSYSRFEEERSNLLSSYARRAEMIQTAMNNMEGCS
CNQVEGAMYAFPRINIPPSAQQIARSQGKQPDVLYALSLLEHSGVCVVPGSGFGQKPGTF
HFRTTILPPEHDFPKVMTSFQKHHEWFLNKYKA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcttaagattttattccagtctttttagacggccagaaacacaagttactcaa
tatttcaagcgcttttgcacagtatcgtccacatacgtttctaactcttatgaaaaggtt
ttaaaaggtggcggtataagtgactcggtgcgagaggcacaatatgctgttagaggagag
gttccaaccagagcgctccaactagaagaagaattgaagcataacaaacagagaccttac
gaccatatcattttttgtaatgtgggaaacccacaatcccttgaaaatccacctatcacg
tatgttcgacaggttcttgctctttgtgattttccggagcttttgaactccaatcttttc
cctgctgacgcgaaggagcacgcaaaacgaatattgattagtgctggaaaaggagggagt
ggggcttacagtaactctggtggagtaagttgtattcgtgaggatattgttgactttatc
caacggagagatggctacgagtcatcagtcaacaacgttttcctcacaaacggagcgtca
gatggaatagctttaataatgaagttgctggtatcatcttccaactccggtgtcatggtt
cccgttccggaatatcctttatatagtgctctgctgtctttattaggagccaaacctgtt
cgatactacttgaatgaagacagaaattggtcaattgagctttccgagctagagagagcc
tatgaaagttcaaaaaaggctggaatttcaataagtgggattgttttaatatccccagga
aaccctactggtcaagttttggagaaatcgaacctcgaagaaataatagattttgcgtat
agaagaaggcttgttgttttagcagatgaagtatatcaagaaaatgtttacacaaaagga
aagaaattcgtatctgtcaagaaggttttgcgtgacatgcctggcaagtatcaagatgtg
gagttggcaagttttcattcggcatctaaaggattctatggtgagtgtggtagacgcgga
ggttatcttgaagttgcaaacttcaatgaagaggcccttgagcaattgtataagctcgcc
tcaatcaatctttgtgccaatttaaacggccagatagcaatgtcatgtatcacacgacat
cccacacaaggaatgccatcttattcccgcttcgaagaagaacgatcaaatttgttgtcg
tcatatgctcgaagagcagaaatgatacagactgcaatgaacaatatggagggttgttcc
tgtaatcaagttgaaggagcaatgtacgcctttcctcgaataaatataccaccatcagct
cagcagatagcaaggtcacaagggaagcaacctgacgttctttatgcgctgtcgttgttg
gaacattctggtgtctgtgtggttccaggaagcggttttggtcaaaaacctggaacattc
cattttcgaacgactatacttccccctgagcatgattttcctaaagtgatgacttctttt
caaaaacaccacgaatggtttcttaataaatacaaggcctag

DBGET integrated database retrieval system