KEGG   Galdieria sulphuraria: Gasu_04150Help
Entry
Gasu_04150        CDS       T02926                                 

Definition
(RefSeq) beta-amylase isoform 1
Organism
gsl  Galdieria sulphuraria
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_14
Motif
Other DBs
NCBI-GeneID: 17090911
NCBI-ProteinID: XP_005708840
UniProt: M2X742
Position
Unknown
AA seq 532 aa AA seqDB search
MRLILLCQQKLIRNLRWFYFLGRRTCLVCLLLLSCSICWRLVVPANDRVSEIRYQTASKD
AIPMNVLNYSSFGVPVYVMMPLSSVTVSGDLVENYDGYDLQWILKQWKKNGVYGLMVDVW
FGVVEKTPKQYRWEPYIQLCKHLRQAGLKLQTVMSFHRCGGNVGDRCYIPLPQWVLDAAA
NNSDIFFKDQEGNVDPEYISWGVDMEPVIAGRSAIQIYSDFLASFRDNLREFLGDVIVQV
QIGLGPAGELRYPSYQLNRWTFCGVGEFQCYDRYLLSRLEQAAKEVEHPDWAHPPYPYDV
GNYNSRPEQTLFFKEDGGIWNTQYGDFFLRWYSKEMIEHADRILQVANDVFFNDKIPDSN
WKGKVRLAIKIAGVHWNFRSKSHASELTAGYYNTRFRDGYTPIFQILKKYDTTAVFTCTE
MRDKNQPQDCNCSPEDLVGLIVRASIATNVSFAGENAVSFYDADSYRQISLVARSYSVVR
GIPMEAMTYLRWPEPITIFMGDNFITPLGQKFFEFVRVMGTDDAISHVIPVF
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgagattgattctactttgccagcagaagcttattaggaacttgcgttggttttacttt
ttaggtcgtaggacttgtttagtttgtttactgttgctaagttgttctatttgctggagg
cttgtggttcctgccaacgatcgagtttctgaaatccgttaccaaactgcttctaaagat
gctattcctatgaacgttctcaactattcttcctttggtgttccagtgtatgttatgatg
cctttgagttcggtcactgtctccggcgatcttgtggagaattatgatggctacgacttg
caatggattttgaagcaatggaaaaagaacggagtatatggtcttatggtggacgtgtgg
tttggagttgtagaaaagacaccaaagcaatatcgttgggaaccctatattcagttgtgt
aaacatcttagacaagctggtttgaagcttcagacagttatgagttttcatcgctgtgga
ggaaacgttggggatcgctgttatatacctcttccgcagtgggttttggatgctgcagct
aacaattcagatattttttttaaggatcaagaaggaaatgtggatccagaatatataagt
tggggagtagatatggagccagttattgcaggacgttcggccatacaaatatattcagat
ttcttggcttcttttagagataatcttcgcgaatttcttggcgatgtaattgtgcaagtc
caaattggcttaggtcctgctggtgagttgagatatcctagttatcaattgaatcgttgg
accttttgtggcgttggagagttccaatgttatgatcgctatcttctctcaagactcgaa
caggcagccaaagaagtagagcaccctgactgggctcatccaccatatccttacgacgtc
ggcaactacaacagcagaccagagcagacgttgttttttaaagaagatggtggcatttgg
aatactcaatatggagacttctttcttcgatggtattcgaaagaaatgattgagcatgcc
gatcgtatacttcaagttgcaaatgacgtattttttaatgataaaattcccgactctaat
tggaaaggaaaggttcgcttagcaattaagatagctggcgttcattggaattttcgttcc
aagtcacatgcttcagagctcactgctggttactataatactcgtttccgagatggatat
actcctatatttcaaatcctaaagaagtatgacacaactgcggtttttacttgtacagaa
atgcgcgataagaatcagccgcaggattgcaattgttctccagaagatcttgtgggactg
attgtacgtgcttctattgcaaccaatgtttcatttgctggagaaaatgcagtgagtttt
tatgatgcagattcttatcgacaaatttcattggtggcacgttcttactcagttgtgaga
ggaatccctatggaggcaatgacctatttgagatggcctgaacctataactatattcatg
ggagataattttataactccgttgggtcaaaaattttttgagtttgttcgagtcatggga
acagatgatgccatcagtcatgtgattcctgtgttttga

DBGET integrated database retrieval system