KEGG   Galdieria sulphuraria: Gasu_07890Help
Entry
Gasu_07890        CDS       T02926                                 

Definition
(RefSeq) phosphatidylserine decarboxylase isoform 1
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
gsl  Galdieria sulphuraria
Pathway
gsl00564  Glycerophospholipid metabolism
gsl01100  Metabolic pathways
gsl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gsl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Gasu_07890
Enzymes [BR:gsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Gasu_07890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PS_Dcarbxylase eIF-3c_N
Motif
Other DBs
NCBI-GeneID: 17090646
NCBI-ProteinID: XP_005708563
UniProt: M2Y7K5
Position
Unknown
AA seq 223 aa AA seqDB search
MRFRHVLVATLSITTGTALATTVAVQRLDSDLNKRVQPFQPHTVQYLQKLPLKTITACWA
WLGSRNLPTPLREPTYRCYCNIFGCNAEEASEPLSNYHNLHQFFARSLRPGARVFQEHAV
LNAPSDGTVVNCGRVVDDQIEQVKGMPWKLTHLIPCGNGSPYQNYGDDTKSLFFLITYLA
PGDYHNFHSPCDWHIQQCRHHTGSLLPVAPVTIDYTYLVSATE
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttcgccatgtgttggttgccacactttccattacaacaggaacagctctggct
actactgttgctgttcaaagactggactccgacctgaataaacgagtacaaccattccaa
cctcataccgttcaatacttacaaaagttacccttgaaaactatcactgcttgttgggct
tggttgggaagtcgaaatcttccaactccactgcgagaaccaacctatcgatgttattgt
aatatatttggttgtaacgctgaagaggcaagtgaaccgctttccaactatcacaacttg
caccagttctttgcaagatccttgagacctggagcaagagtctttcaagaacacgctgtt
ttgaatgcgcctagtgatggcacggttgtcaactgtggaagagttgtcgacgatcaaata
gaacaagtaaaaggtatgccttggaaactgacccatttgataccttgcggaaatgggagt
ccttatcaaaactatggagacgataccaaaagcctattctttctgataacctatttggca
ccaggagactatcacaacttccactcaccttgcgattggcatattcaacagtgtcgtcac
catacaggatcattattacctgttgcaccggtaactattgactatacctatctggttagc
gcaacggaataa

DBGET integrated database retrieval system