KEGG   Galdieria sulphuraria: Gasu_09330Help
Entry
Gasu_09330        CDS       T02926                                 

Definition
(RefSeq) beta-galactosidase
Organism
gsl  Galdieria sulphuraria
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 BetaGal_dom4_5 BetaGal_dom2 BetaGal_dom3 Glyco_hydro_42 Glyco_hydro_2_N
Motif
Other DBs
NCBI-GeneID: 17090477
NCBI-ProteinID: XP_005708381
UniProt: M2W7S2
Position
Unknown
AA seq 958 aa AA seqDB search
MSSVYGKYTTGNVTYDKYSLIIDDERQFIYSGAFHYWRLPSPSLWRDILEKLKSAGMSAT
TVYFAWSYHSPKSHLYNFEGVRDIDRLFNMIREVGLYLISRPGPYINAETNAGGFPGWLV
SSLKGLARTDDPYYTAAWEQWLSAVDPHLEKFQSPYDGPIIAVQVENEYDVGNLSAKYME
LLEAKFRKDGIVVPLTTNVYGDRSTWTSGPGAVDIQGIDSYPQGFDCRNPSEWHAIPTYF
ATAHAESNPSEPMYNPEYQGGSFDPWAGPGYYYCYELTNGDFERVFYQNQIAQGETMLNF
YMTFGGTTWGWLPFPGVYTSYDYGAAINEGRQLTDKYSEQKLMANFFRVFHPLRKMDSIQ
VASPTNPTLYLQGRENKDDGTQLYILRHQDGTSITKETTKILVQGILGDYQIPREEGTYI
LIDRRDSKMLPCFYNFGNQYLVYSTAEMMTHTTVQGESGKVDTAIFYLGEMQYGELLFYF
QNAVFEPSIEVFEGQLQNSHWDASRNQLRINYQQSQVIRLMISSQQRPLYLILASREVAK
RWWNIESNEGDVLVSGPYLVRSAKYTEDGGLHLRGDTEIETQLKVVPSKVTTYLTWNGEY
LENVKHESPLTLVTTLPGPPPVILPSLDFWKFKYGTPEKEPSFDDSDWIVADKNHTNCPF
KPITLPVLYMDDYGFHVGDVWFRGRFSSEETVKGIVLTGEGGDFSVYSVWLNGHFLGTAE
NGTETFYFKKEELVSQGDNVIAILLENMGHDEDYTNTHNKWQHPRGLVQARLISGCSCNS
DTSDIPIYWKIQGNLRGEEYIDSARGPFNNGGLYGERHGWYLPGFPDEDWEQIILPHRFS
DAGVAWYRTTFELDIPEGVDASIGVRIEDTDPNSRYRALIFLNGWMLGHYINYVGPQHFF
ALPTGILNPRGSNQLSIAVWGQEGGEGLSHVALETYAVHLGGVPVEMVYSPDYKELFQ
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atgagctcagtgtatggaaaatatactacaggaaacgtaacatatgataaatattccctc
attatagatgatgaacggcaattcatctattctggagctttccactattggcgtttacca
agtccttcattatggagagatattcttgagaaactcaaatccgctggaatgtcagcaact
acagtctactttgcttggtcatatcattctccaaagtctcatctctataacttcgaggga
gttcgagatattgacagacttttcaacatgataagagaagtaggattatatcttatttct
aggcccggaccttacatcaatgctgaaaccaatgctggaggctttccaggttggttagtg
tcatctttgaaaggactcgcacgaactgacgacccatattatactgctgcctgggagcaa
tggttatctgcggtcgacccacacttggaaaagtttcaaagtccttatgacggtcctatt
attgcggttcaggtggaaaatgaatatgacgtgggaaaccttagtgcgaagtatatggaa
ctgttagaagctaaatttagaaaggatggaatagttgttccgttaacaaccaatgtatat
ggtgatagatctacgtggacttcgggtccaggagcagtggacattcaaggaatagatagt
tatcctcaaggttttgactgtaggaatccttctgaatggcatgcaattcctacctatttt
gcaacagcgcatgcagaaagcaatccatcagagccaatgtacaacccagaatatcaagga
ggttcttttgatccttgggctggtccaggatactattattgctatgagttgacaaacgga
gatttcgaaagggttttttatcaaaatcaaattgcacaaggagaaactatgttaaacttt
tacatgacgtttggtggaacaacttggggctggctaccatttcctggtgtttatacttcc
tatgattatggtgcagctataaatgaagggcgtcaactaactgacaaatattcggaacag
aagttgatggcaaatttcttccgagtctttcatcctttaaggaagatggattctattcaa
gttgcaagtcctaccaatcccactttgtatttacaaggcagagaaaataaagatgatgga
acccaattatatatcttgagacatcaagatggtacttcaataacgaaagaaacgacaaag
attcttgttcaaggtatacttggagattatcagatacctcgtgaggaaggaacttatatt
ctgatcgacagaagggactccaagatgctaccttgcttttataactttggaaaccaatat
cttgtatattctactgctgaaatgatgactcatacaactgtccaaggagaatctggaaaa
gttgatacggccattttctatctcggagaaatgcaatatggagaactcttgttttatttc
cagaatgccgtatttgagccatctattgaagtttttgaaggtcagttgcaaaactcgcac
tgggatgcttctcgcaatcaattgcgtatcaactatcaacaaagtcaagtcattcgtttg
atgatatcttctcaacaaagaccactttatttgatcttggctagtcgtgaggttgcaaag
aggtggtggaatatagaatccaatgaaggggatgtgctagttagtggtccttatttagta
agaagcgcaaagtatacggaggatggagggttacatttgagaggtgatactgagattgaa
acgcaactcaaagtagtgccatcaaaagtcacaacataccttacgtggaatggtgaatat
ttagagaatgtgaaacatgaaagtccacttactttggttactacacttccaggacctccg
cctgttatcttaccttcattagacttttggaaattcaaatatggaacaccggaaaaggag
ccatcgtttgatgatagcgattggatagttgcagataagaatcataccaattgtccattc
aagcctataactcttcctgttttatatatggatgattatggtttccatgtaggagatgta
tggtttcgaggtcgattttcttccgaagagacagttaagggcatagtcttgacaggagaa
ggtggtgattttagtgtttattcagtatggctaaatggtcactttttgggaacagcagag
aatggaacagaaacattttatttcaagaaggaagagttagtatcacaaggtgacaatgtg
attgctattctattggagaatatgggccatgatgaagattataccaatactcataacaaa
tggcaacatccaagaggtttagtacaagcacgattgataagtggttgtagctgtaatagt
gatacctcagatattcctatatattggaaaattcaaggtaacttgagaggtgaagaatat
attgattcagctcgaggtccattcaataatggtggtttgtatggagaacgtcatggatgg
tatcttccaggttttccagatgaagactgggaacaaattattcttcctcatcgattttca
gatgcaggtgttgcttggtatagaacaacctttgagttggatatacctgaaggtgtcgat
gcttccattggagtacgaatagaagatacagacccgaatagtcgttacagggctcttatc
ttcttaaatggctggatgctcggtcattatattaattatgtgggaccacaacatttcttt
gctttaccaactggaatacttaacccaagaggaagcaatcaactttctattgctgtttgg
ggacaagaaggtggagaaggcctgtctcatgttgctctggagacatatgctgttcatctt
ggtggtgttccagtggaaatggtttacagtccggactataaggagctcttccagtga

DBGET integrated database retrieval system