KEGG   Galdieria sulphuraria: Gasu_18960
Entry
Gasu_18960        CDS       T02926                                 

Definition
(RefSeq) delta14-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
gsl  Galdieria sulphuraria
Pathway
gsl00100  Steroid biosynthesis
gsl01100  Metabolic pathways
gsl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gsl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    Gasu_18960
Enzymes [BR:gsl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     Gasu_18960
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 DUF5392
Other DBs
NCBI-GeneID: 17089601
NCBI-ProteinID: XP_005707403
UniProt: M2Y4M1
Position
Unknown
AA seq 391 aa
MNLIGYSLLCTFVIAILFQQLYQTKDFVVFFNLNWFPNKNTTFVAVLYILFLAVLGEILP
GKTFPGSTLEDGSRLYYKCNGFSVLLSTVAMFVTCHYARVIDGTWISRHYFDLFVSANWI
ALCLATYLFLSHKLFGRKNWLRNRSFLSDFILGSELNPFIWKINVKFFWLRPSMIGWCLI
NLSHLFFQFIQHQSISARMVVYQLLTNLYIIDYFYNEVKMTTTWDIIAEHFGLMLIWGDI
VFIPFVFSIQCRYLVDNFLPMKFWEWILIALCAFVGIFMFRSSNSQKHQFKHHPEAKIWG
KQPETIGGKLLVSGFWGIARHINYTGDLLLALSFCLPCGYKTVIPYFYFLYLLLLLVHRD
MRDEQRCANKYGALWEEYCRRVPYRLVPYFY
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgaacttgattggttattcgctattgtgtacatttgtgatagctatattatttcagcag
ctttatcaaaccaaagactttgtggtattctttaatttaaattggtttccaaataagaat
actacttttgtagcggtcttgtacatactgtttctagcagtcttaggtgaaatactacct
ggtaagacgtttccaggttctactttagaagacggttctcgcctatattacaagtgtaat
ggcttttcagttttattatctaccgttgctatgttcgttacttgtcactatgccagagtt
atcgatggaacttggatttctcgtcattactttgatcttttcgttagtgcaaactggatt
gctctttgtttagctacatatctgtttttatcgcataagctatttggaaggaagaactgg
ttgaggaatcgcagtttcttatccgattttattcttgggagtgagctgaacccctttatt
tggaagattaacgtcaagttcttttggttgaggccgagtatgattggttggtgtcttatc
aatctttctcatttattcttccagtttatccagcaccagagtatttcagctcggatggtt
gtttatcagctattgaccaatctttatatcattgattacttttacaatgaagtaaagatg
accacaacttgggatatcattgcggagcactttggtttgatgcttatttggggtgacata
gttttcattccatttgtcttttctattcagtgtcgctatttagtcgataattttcttcct
atgaaattctgggaatggatattgattgctttatgtgcctttgtcggtatttttatgttt
cgtagctcgaattcacaaaagcatcaattcaaacatcatccagaagctaagatttggggg
aaacagccggaaacaatcggagggaagttattggtctctggtttctggggtattgcaaga
catatcaattataccggagatttactattggcactttcattttgtttaccgtgtggctat
aaaacggttattccttatttttactttttatatcttttgttattattagtacacagagac
atgcgtgatgaacaacgatgtgcaaacaaatatggtgctctttgggaagagtactgtcgt
cgcgtaccttatcgtctcgttccttatttttattaa

DBGET integrated database retrieval system