KEGG   Galdieria sulphuraria: Gasu_34300Help
Entry
Gasu_34300        CDS       T02926                                 

Definition
(RefSeq) short-chain dehydrogenase/reductase (SDR) family protein
  KO
K11153  retinol dehydrogenase 12 [EC:1.1.1.300]
Organism
gsl  Galdieria sulphuraria
Pathway
gsl01100  Metabolic pathways
Brite
Enzymes [BR:gsl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     Gasu_34300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase GDP_Man_Dehyd NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 17088046
NCBI-ProteinID: XP_005705754
UniProt: M2Y071
Position
Unknown
AA seq 361 aa AA seqDB search
MALVQLASLKVFLKKPFVTSDVLSDFLFGRFKLMNCAELENSSLKNKTALVTGCNTGIGY
ATCLKLAKAQARILICCRTMQKSIATADSLRRELGIHDKGRFCCFEADMENLDAVTTLAQ
DIIQLNEQIHFVILNAGVMQAANKKITKNGLELHFAVNHMSHFLLTYLLMPQLIRSAPCR
IIVVTSNAYEYGKPEQLADHRFQSFPYIAVSAYAQSKLANILFAYELKKRFKDKGIDVFA
VHPGAVLSDIYREEWLLHAPLVGFFTQKVLSRIMRTPQEGGKTIAALLGDALFSSSLREG
YSDACFSNLYWKDCKPQPVNSNLVNDISAEFLWRLSISILKDLGILNDERLEMVELCEKT
N
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcattggttcaactggcatctctgaaagtatttttgaagaagcctttcgttacatca
gatgtgctctctgattttctcttcggtagattcaagcttatgaactgtgcagagcttgaa
aacagttcgctgaagaataaaacggcactcgtgacaggctgtaatactggaataggctat
gcaacttgtctgaaattagctaaagctcaagctcgaatcttgatatgctgtagaactatg
caaaagtcaatagccactgcagatagtttgagaagggagttgggtattcacgacaagggt
cgcttttgttgtttcgaggcagatatggagaacttggacgccgtcacaactttggctcaa
gacatcattcagttgaatgagcaaatacacttcgttatattgaatgcaggcgttatgcaa
gcagcaaacaagaaaatcaccaaaaacggactggagctgcatttcgctgtaaatcatatg
agtcactttctattaacatatctacttatgcctcagttaatacgaagtgcaccatgtcgc
attattgtagtcacttccaatgcttatgaatacggcaaaccagagcagctggccgatcat
cgctttcaaagctttccttacatagctgtctctgcatatgcccagagtaaacttgcaaac
atattgtttgcttatgaattgaagaaacggttcaaagataaaggaatagatgtgtttgct
gtgcatcccggtgcagtgttatcagatatttatcgtgaagagtggttattacatgctcca
ttagtcggattcttcacacaaaaagttttatctcgtatcatgaggactccgcaggaggga
ggaaaaacaattgcagctttgcttggcgacgctctattttcttcaagtctacgagaaggt
tattccgatgcgtgtttttccaacctttattggaaagactgcaaaccacaaccagtaaat
agcaaccttgtcaacgatatttctgctgagtttctatggcgactttccatatccatactc
aaagaccttggaattttaaacgatgagcgtctcgaaatggtagagctttgcgaaaagaca
aattga

DBGET integrated database retrieval system