KEGG   Galdieria sulphuraria: Gasu_48340Help
Entry
Gasu_48340        CDS       T02926                                 

Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
gsl  Galdieria sulphuraria
Pathway
gsl00450  Selenocompound metabolism
gsl00970  Aminoacyl-tRNA biosynthesis
gsl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Gasu_48340
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Gasu_48340
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gsl01007]
    Gasu_48340
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gsl03016]
    Gasu_48340
Enzymes [BR:gsl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Gasu_48340
Amino acid related enzymes [BR:gsl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Gasu_48340
Transfer RNA biogenesis [BR:gsl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Gasu_48340
 Prokaryotic type
   Other AARSs
    Gasu_48340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 DUF1148 DUF4431
Motif
Other DBs
NCBI-GeneID: 17086580
NCBI-ProteinID: XP_005704213
UniProt: M2XVL2
Position
Unknown
AA seq 625 aa AA seqDB search
MSISRIHIHLCFAQQALTCVQKTHSFFKPCHFNRSLGKLGSLFKKRGKSVAASRSYKASL
DRHQILNREQKTNSLSDLSKIWRISCNDEERAELKSYEGRRVVLTTPLYYANASPHMGSA
YPTIAVDVLSRFYRLLGAKPVFITGTDEHGEKVATAAAKHKKSPLEHCDSVVEQFLNLWN
KFGIRFDRFIRTTEKGHEALVSQFIQRVYDNGDIYKDTYDGLYCVDCEEYKDGEGLTENN
LCKIHRKECVQRSEENYFFALSKYQKKLEKLLDENPLFVQPPERLNEVKGWLRQGLRDFA
VSRANNVWGIPVPFDPTHSVYVWFDALSGYLSALFACEEEGISLDRLSDLGWPAEVHIIG
KDILRFHALYWPAMLMSGGLQLPKRVFGHGFLTKDGMKMGKSVGNTLDPVELVDSYGKDA
VRFYFIRGIVFGDDGDFSRERFIQVVNSELANNIGNLLHRSLNLLGKYCEFKIPVSSSAV
VSATHPLRLTAESMAEKAKVCYHRLDFATACETMIHLAAEANQYIAYEQPWACFKSGEAN
KAVQCLVACLETVRIVATGLSPVTPEFSKQIYLSLGYPEEYFKMLFWDRDMKWGGLKAGV
SFDRPKVIFPKIVSYEETLSSSLSH
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcagtcgaattcatatccacttgtgtttcgcacaacaagcgcttacgtgcgtt
cagaagacacatagctttttcaaaccctgtcatttcaatagatctttgggaaagttaggt
tccctattcaagaagagaggcaaatctgtagctgctagccgttcatacaaggcctctctg
gaccgccaccaaattcttaacagagagcagaagacaaactccttgtcagacttgtcgaaa
atatggagaataagctgtaacgatgaggaaagagcagagctaaaaagttatgaaggcaga
cgcgtagtactgacaacgccactatactatgctaacgcctcaccacatatgggaagtgct
tatccaaccatagctgtcgatgtgctttcaagattctacagattactcggagcaaagcca
gttttcatcacaggaaccgacgagcacggagagaaagttgcaactgctgctgcgaaacac
aaaaagagtcctctcgaacattgcgactctgttgtggagcaatttttaaatctatggaat
aagtttggcatccgttttgacagatttatccgaacaacagaaaaaggtcacgaggcattg
gtttcacaatttattcaaagagtttatgacaacggagatatttacaaagatacttatgat
ggtctttattgcgtcgattgcgaagaatataaagatggcgaaggcttaacagaaaataac
ctttgtaagattcaccgtaaagaatgcgtgcagcgttcggaagaaaactacttttttgca
ctttccaagtatcaaaaaaagctagagaagctattagatgagaatcccctctttgtgcag
ccacctgaaagactaaacgaagtaaaaggttggttgagacaaggtctacgagattttgct
gtttcacgtgcaaacaatgtttggggaattccggttccctttgatccaacacattctgtg
tatgtttggtttgatgcattgagcggatacctttcagcattgtttgcttgtgaggaagaa
ggcatctccttggacaggttgtcagatttaggctggccagcagaagtacacattatcggt
aaagatatactacgctttcatgctctatactggccagcaatgctaatgagtggtggatta
caacttcctaagcgagtatttggacatggtttcttgacaaaggatggcatgaagatggga
aagtcagtcggaaatacacttgatcctgttgaactagtggattcctatgggaaagatgca
gttcgattctattttattcggggaatagtttttggagatgacggagacttttcgagagaa
aggtttattcaagttgtcaattcagaattggccaacaatataggcaatttgcttcatcgc
agtttgaatctattaggaaaatattgcgagtttaaaatcccggtatcttcgtctgctgta
gtgtcagcaacacatccactaaggctaactgcagagtccatggctgaaaaggcgaaagtt
tgctatcatcgtttggattttgccacagcctgtgaaactatgatacacttagcagcggaa
gcaaatcaatacattgcatatgaacaaccatgggcttgctttaaaagtggagaagcgaac
aaggctgtccagtgtctcgtcgcttgtttagaaactgttcgaattgtggctacgggctta
tctcctgtaacacccgagttttctaaacaaatttatttgtctctaggttatcctgaagaa
tatttcaaaatgttattctgggatagggatatgaagtggggtggtttgaaagcaggtgtt
tcgttcgatcgaccgaaagttatttttcctaagattgtatcttatgaagagactttgagc
agctcattgagtcattga

DBGET integrated database retrieval system