KEGG   Galdieria sulphuraria: Gasu_51810Help
Entry
Gasu_51810        CDS       T02926                                 

Definition
(RefSeq) fructose-bisphosphate aldolase, class I
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
gsl  Galdieria sulphuraria
Pathway
gsl00010  Glycolysis / Gluconeogenesis
gsl00030  Pentose phosphate pathway
gsl00051  Fructose and mannose metabolism
gsl00710  Carbon fixation in photosynthetic organisms
gsl01100  Metabolic pathways
gsl01110  Biosynthesis of secondary metabolites
gsl01200  Carbon metabolism
gsl01230  Biosynthesis of amino acids
Module
gsl_M00165  Reductive pentose phosphate cycle (Calvin cycle)
gsl_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
gsl_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:gsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gasu_51810
   00030 Pentose phosphate pathway
    Gasu_51810
   00051 Fructose and mannose metabolism
    Gasu_51810
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Gasu_51810
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gsl04131]
    Gasu_51810
   03036 Chromosome and associated proteins [BR:gsl03036]
    Gasu_51810
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gsl04147]
    Gasu_51810
Enzymes [BR:gsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Gasu_51810
Membrane trafficking [BR:gsl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Gasu_51810
Chromosome and associated proteins [BR:gsl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    Gasu_51810
Exosome [BR:gsl04147]
 Exosomal proteins
  Proteins found in most exosomes
   Gasu_51810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic Peptidase_M61
Motif
Other DBs
NCBI-GeneID: 17086128
NCBI-ProteinID: XP_005703720
UniProt: M2WTH4
Position
Unknown
AA seq 419 aa AA seqDB search
MTVAFVGSTNFSANLFGSKNKHGLQSKSFLGVSVSSEHPISRVQFTPAGGKSRIVCLSWG
VKGGVEKFADSLIETARSIASPGKGILAVDESTKTIGKRLASIGVENTEENRQAYRELLF
TCEGLGQYISGAILFEETLYQNARNGKSFVDCLRGVGVIPGIKVDKGLSPLPGGEAIETW
CTGLDGLSERAAAYYKQGARFAKWRAVLQISPETPTELCVQENARGLARYAKTVQEQGLV
PIIEPEILMDGDHDIERTAQVQEHVLATVYKECDSNGVLLEGSLLKPNMTVPGADCKRQV
SAEDIARYTIRTMERRVPSAVPGIMFLSGGMSEEEASVYLNVMNKIQRRGPWSLSFSYGR
ALQQSCLKSWKGKQENVKAAQEALLARARANSKANLGKYVPGSEPTLDKTGTFEKAYVY
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcgcctttgttggttctacaaacttcagtgcaaacctttttgggtctaaaaat
aagcatgggcttcaatcaaaaagctttttaggtgtttcagtttcttctgaacacccaatc
tctagagtccaattcactcctgctggaggcaaatctcgtatagtgtgtctttcttgggga
gttaaaggaggtgttgaaaagtttgcagacagcttgatcgaaactgctcgttccatagcc
tcacctggcaagggaatattggcagtggatgaatctacaaagaccatcggaaaacgcttg
gcttctattggagttgagaatacagaggaaaaccgtcaagcatatcgggaattgttgttt
acctgtgagggactgggacaatatatttcgggcgcaatcctttttgaagaaactttatac
cagaacgcacgtaacggcaagtcatttgttgattgtctgagaggagtgggtgtcattcct
ggtatcaaggtagataaaggattatcaccgttacccggtggagaagctattgaaacttgg
tgtactgggcttgatggtctgagtgaacgagcagctgcttactacaaacaaggtgccaga
tttgccaaatggcgagcagtgttgcagatatctccagaaacacccactgaactttgtgtt
caagaaaatgctcgcggtcttgctcgatatgctaaaactgttcaggaacagggtctggtt
cctattattgagccagaaattttgatggacggtgaccacgatatagaacgcacggctcaa
gtgcaagaacatgttctggcaaccgtttataaggaatgtgatagtaatggagttttactg
gaaggttctctgctgaagcccaatatgaccgttccaggcgcggattgtaaacgacaagta
agtgcggaagacattgcacgatatacaatcagaacaatggaacgtcgagttccttctgcc
gtacctggaattatgttcctttccggtggtatgtccgaagaagaagcttcggtctatctc
aacgttatgaataagatacaacgtcgtggaccttggagtttgtcgttttcatatggtaga
gctctgcaacaatcctgtttaaagagttggaagggtaagcaagaaaatgtgaaggcagct
caagaagccttacttgcaagagctcgagctaactcaaaagctaatttggggaagtatgtt
ccgggttctgagcctacgttagataagacgggaacctttgagaaggcttatgtctattaa

DBGET integrated database retrieval system