KEGG   Galdieria sulphuraria: Gasu_59080Help
Entry
Gasu_59080        CDS       T02926                                 

Definition
(RefSeq) dTDP-glucose 4,6-dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
gsl  Galdieria sulphuraria
Pathway
gsl00520  Amino sugar and nucleotide sugar metabolism
gsl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Gasu_59080
Enzymes [BR:gsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Gasu_59080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind adh_short KR
Motif
Other DBs
NCBI-GeneID: 17085437
NCBI-ProteinID: XP_005702937
UniProt: M2X9C4
Position
Unknown
AA seq 321 aa AA seqDB search
RGYYAPNRPSHHKRILVTGGAGFIGSHLVDRLMEEGXEVIVVDSLFTGKKSNILRWLXNP
KXEFVRHDVTLPYQAEVDQIYHLACPASPVHYKYNAXKTVKTNVLGTMNMLGLAKRVGAR
FLLASTSEVYGDPQVHPQSEEYWGNVNPCGLRSCXXEGKRVAETLTMDYSRQHGVEVRIV
RIFNTYGPRMVENDGRVVSNFVTQALEGKPLTLYGDGKQTRSFCYVSDLVDGMIRMMNSE
HAGPLNLGNPEEFTVESLAHIVREMVNPNLEIVHMAATPXDPTRRQPDITKAKNLLNWQP
KVRLRDGLSLMXEEFRERCNL
NT seq 967 nt NT seq  +upstreamnt  +downstreamnt
gcgcggctattatgctccnaatcgtcccagtcatcacaagcgtatattagtcactggtgg
agcaggtttcattggttcacacttggtcgatcgccttatggaagaaggcaangaagttat
tgtggtagacagtcttttcactggaaagaaaagcaacattttgaggtggctnaanaatcc
caagttngagtttgttcgtcacgatgtcaccttaccttatcaagcagaagtagaccaaat
atatcatcttgcctgtcctgcgtctccagtccattacaagtacaacgctatnaaaaccgt
aaagacnaatgtattgggaactatgaatatgttgggtttagcgaaacgcgttggagctcg
ttttttattggcttctacttcngaagtctatggagatcctcaggttcatccacagtcaga
agagtactggggnaatgtgaatccctgtggtttgagaagttgttangangaagggaaacg
tgtagcagaaacgttgacgatggattattcacgacaacatggtgtggaagtccgtattgt
gcgaatattcaatacttacggacctcgaatggtngaaaacgatggacgagttgtgtccaa
ctttgtgacacaggcactcgaaggaaagcctttgacattgtatggagatggnaaacagac
tcgttcattttgttatgtttcggatttagtggatggaatgattcgtatgatgaattccga
acatgctggtccgctgaatttaggnaatccggaagagtttaccgtagagtctttagcaca
tatagtccgngaaatggtaaatccnaacctngagatagtacatatggcagctacaccnga
ngatccaacnagaagacaaccagatattaccaaggccaaaaacttattgaattggcaacc
aaaggttcgattacgngatggattgagtttgatgatngaagaatttcgagaacgttgcaa
cttgtaa

DBGET integrated database retrieval system