KEGG   Galdieria sulphuraria: Gasu_61200Help
Entry
Gasu_61200        CDS       T02926                                 

Definition
(RefSeq) cytochrome-b5 reductase
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
gsl  Galdieria sulphuraria
Pathway
gsl00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:gsl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Gasu_61200
Enzymes [BR:gsl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Gasu_61200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 DUF1517 LysM
Motif
Other DBs
NCBI-GeneID: 17085225
NCBI-ProteinID: XP_005702761
UniProt: M2VSV8
Position
Unknown
AA seq 623 aa AA seqDB search
MCTASQLCKFSSPVCRTRLFCCSLQKTKQNKERGQIQASKRMKCSRSENSLNAQKLFETQ
LTQSYKLVQVLKKPLATFAARSSGRIGGSQFSDPRMTPPPRSYEYGGGGSGTGSFYSPFP
ATPINIFGGFYSSPFIAHFGFGNFMMFLTTAGTIFPRETGNRNFGISKLGCYKCHRRFSV
VYEAGARSVSCKHNQKGQQLSHTQRSKRIGDWIIVQENEDIRSFAERFQVSPEALRVANG
LETCQEELKQGEIIFVPYVNVQRKMELSRQLQLSLTKTQSVDLDRKYSVVSQASNASIPK
GRLSLFPFISIVVIMASLLYFLSEYGTGSLAMISGLLRKRALGALSYPQQFLQLKKLKVE
ENEGMEWILCTLRQRRXELVPGMTRYTFDLPSARRTLGLELGQRVEFEATLYEKEHAVMG
SYLLCTERMQHGNFDVVIPTTADAAISGFDLSGNKDPQFAEALNALQIGDSIRMRPGAKM
LYYRGPKSPVDTLSVVCGGVGVAPICSLLLDILSDVESAVTNVFLLVVNERPDEFIFLDE
LESLEKRFPRILRLACVWKKVEEENSWDDREKYHFIERAVASHCPVWKEGTMSLLCGSEK
WLLPHALKSFRRLGYSEEVTVCL
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgtgtacagcctcgcagctctgcaagttttcttcccctgtttgcagaacaagactgttc
tgttgcagcctccagaaaacaaagcagaacaaggaacgaggccaaattcaagcgtcgaaa
agaatgaagtgttcaagaagtgagaatagtttgaatgcacaaaagttgtttgagacgcaa
ctgacacagtcttacaaactggttcaagtcttgaaaaagccattggccaccttcgctgca
aggtcgagtggaagaattggagggagtcagttttctgatccaagaatgaccccacctcct
cgttcttatgaatacggaggtggaggtagcggaacgggttctttctattctccttttcct
gcaacccctattaatatttttggagggttttattcttcaccttttattgcacattttggc
tttggtaacttcatgatgtttctcaccacggcaggaactatttttcctagagaaacagga
aatagaaactttggaatctcaaagttaggttgttacaaatgtcatcgcagattttcagtt
gtatatgaagctggcgcaaggtcggtctcttgtaaacacaaccaaaagggtcagcaactg
tctcatacccagcgttcaaaacgaatcggtgattggatcattgttcaggagaacgaagac
attcgctcctttgctgaaaggtttcaagtatccccagaagctctcagagtagccaatggt
ttggaaacttgtcaggaggaattgaagcaaggagaaatcatctttgtaccttacgttaac
gtacagagaaaaatggaattgtccaggcaacttcaattgagtttaactaaaactcaaagt
gtagacctagacagaaaatactccgttgtttcgcaagcaagtaacgcgagcatacccaaa
ggacgactcagcctgtttccatttatttcaatagtagttattatggcttcacttctctat
tttttgtcagaatatggtacaggaagtcttgctatgatctccgggttgttgagaaaacgg
gcattgggagctttatcttatccacaacaattcttacaattaaaaaagttgaaagtcgag
gaaaatgaaggaatggaatggattctgtgtacattacgacaaagaaggnaggaactggtt
ccgggaatgacaagatatacttttgatttgccttcagcaagaagaactcttggtttggaa
ctcggacaaagggtagagtttgaagcaactctttacgagaaggaacacgctgtaatgggc
tcttacctactttgtacagaacgaatgcaacacggtaactttgatgttgtcattcctaca
acagcagatgcagcaatatctggctttgatttgtctggaaacaaagaccctcaatttgct
gaggcgttgaatgctctacaaattggagacagtattagaatgagacctggagcaaaaatg
ttgtattacagaggaccaaagtctcctgtggacactctttctgttgtttgtggtggagtg
ggtgttgctccaatatgctctttgctgttagacattctttctgacgtggaaagcgctgta
acaaatgtctttcttctcgtggtaaatgaacgcccagatgaatttatctttttagatgag
ttggagtctctggaaaagcgttttccacgtattctacgtctagcttgcgtttggaaaaaa
gtggaagaagaaaattcttgggatgaccgagagaaatatcacttcatagaaagagctgtt
gcaagtcactgtccagtttggaaggagggtacgatgtcattgttgtgcggttctgaaaaa
tggttacttccacacgcgctaaagtcttttcgtcgcctgggatactcagaggaagttact
gtctgcctataa

DBGET integrated database retrieval system