KEGG   Gynuella sunshinyii: YC6258_00636Help
Entry
YC6258_00636      CDS       T03690                                 

Definition
(GenBank) esterase/lipase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
gsn  Gynuella sunshinyii
Pathway
gsn00903  Limonene and pinene degradation
gsn00930  Caprolactam degradation
gsn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gsn00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    YC6258_00636
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    YC6258_00636
Enzymes [BR:gsn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     YC6258_00636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 COesterase DUF2974 Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: AJQ92686
UniProt: A0A0C5VER4
Position
complement(605731..606633)
Genome map
AA seq 300 aa AA seqDB search
MSIDQLNTILQQAAANPPPENSSPIELRKWFEAAYADLPLPDSVIMETVSLGPIGGEFFQ
FPGCDNRKLVIYYHGGGFMFGSTRTHRTISANLARVTGTRVLSVDYRLAPEFMVPTAHDD
AYAAYVWALEQGYNAGNISVGGDSAGGNLALSTVVRARDEGFKLPGSLILMSPALDFADE
GGSHNTKADAPLLNKELAGLFTACYLGNTDRHDSRITPLYANLAGLPPVLLHVGTREFLL
DDTLTLAERLHAANVQVDLRVWPGMCHSWQLFAPFLDEGMASIEQAGQFINTHFKANSNQ
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattgatcagctaaacaccatacttcaacaagccgcagcaaacccaccacctgag
aatagttctccaatagagttgcgtaagtggtttgaagccgcctatgcagacttaccatta
cctgatagcgtcataatggaaaccgttagtcttgggcctatcggcggtgagttctttcag
tttcccggctgtgataaccggaaactggtgatttactaccatggcggtggttttatgttt
ggctctacccgtactcatcgcacaatttccgccaatctggcccgggtaaccggaaccaga
gtgctcagtgttgattatcgattggctcctgagtttatggtacctacggcacatgatgat
gcttatgctgcatatgtatgggcacttgagcagggttataatgccgggaacatttctgtc
ggtggcgattcagcgggtggtaatctggcgctctctacggttgtacgggcgcgcgatgaa
ggctttaaactgcccggcagcctcattttaatgtcaccggcactggattttgccgatgaa
ggcggatcccacaacaccaaggctgatgcccctttgctcaacaaagaactggccggattg
tttaccgcctgctatctcggcaatactgaccgacacgactccagaattaccccactttat
gcaaatctggccggtctaccgcctgttttgttgcatgtgggtaccagagagtttctgctt
gatgacactctgacactggctgaacgacttcacgcagcgaacgtacaggtggacctgaga
gtgtggccgggtatgtgccattcctggcagctatttgcaccttttctggatgaaggtatg
gcttctatcgaacaggcaggccaatttatcaatactcactttaaagcaaacagtaaccag
tga

DBGET integrated database retrieval system