KEGG   Gynuella sunshinyii: YC6258_01132Help
Entry
YC6258_01132      CDS       T03690                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gsn  Gynuella sunshinyii
Pathway
gsn00071  Fatty acid degradation
gsn00072  Synthesis and degradation of ketone bodies
gsn00280  Valine, leucine and isoleucine degradation
gsn00310  Lysine degradation
gsn00362  Benzoate degradation
gsn00380  Tryptophan metabolism
gsn00620  Pyruvate metabolism
gsn00630  Glyoxylate and dicarboxylate metabolism
gsn00640  Propanoate metabolism
gsn00650  Butanoate metabolism
gsn00900  Terpenoid backbone biosynthesis
gsn01100  Metabolic pathways
gsn01110  Biosynthesis of secondary metabolites
gsn01120  Microbial metabolism in diverse environments
gsn01130  Biosynthesis of antibiotics
gsn01200  Carbon metabolism
gsn01212  Fatty acid metabolism
gsn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gsn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    YC6258_01132
   00630 Glyoxylate and dicarboxylate metabolism
    YC6258_01132
   00640 Propanoate metabolism
    YC6258_01132
   00650 Butanoate metabolism
    YC6258_01132
  09103 Lipid metabolism
   00071 Fatty acid degradation
    YC6258_01132
   00072 Synthesis and degradation of ketone bodies
    YC6258_01132
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YC6258_01132
   00310 Lysine degradation
    YC6258_01132
   00380 Tryptophan metabolism
    YC6258_01132
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YC6258_01132
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YC6258_01132
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YC6258_01132
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gsn04147]
    YC6258_01132
Enzymes [BR:gsn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     YC6258_01132
Exosome [BR:gsn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YC6258_01132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJQ93180
UniProt: A0A0C5V0Y4
Position
1123763..1124956
Genome map
AA seq 397 aa AA seqDB search
MQPSSASNQAVIIAARRTPIVRAHGLFKRIDVCGLLTPLIHQLLADSAMPASEIDDVIIG
NATASSGNIARLAALSAGLPITVPGVTVDRQCGSGLEAIIQACRQVQAGAGDVYLAGGVE
SISTAPWRMERPQSADAQPRFFSRARFAPDSIGDPDMGVAAENVARHCGVTRDRQDALAL
QSHQRAVAAQQQGLFAGELVAINTSSGVINTDEGPRASLSKALLARMKPVFDSTGTVTAG
NCCQHNDGAALVLVVSAKRAQKMGLPVAMKFCDATAAGVDPNLLGLGPVPATRKLLRRNP
HISLPEIDLIEFNEAFAAQVLGALYSLGIPAEKINREGGAIALGHPYGASGAVLVTRLFS
QMQRNDSPGQHGLATLGIGGGLGLSALFEYTSLDIHA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcagccctccagcgcctctaatcaagccgttatcatcgccgcccggcggacccccatc
gtccgtgcccatggcctgttcaagcgtatcgatgtctgcggtctgcttaccccgttgatt
caccagctcctggcagacagcgccatgccggccagtgaaatcgacgatgtcatcatcggc
aatgccaccgccagcagtggcaacattgcacgcctggctgcgctctcagccgggctgccc
ataaccgtgcccggtgtcaccgtggatcgccagtgcggctccgggcttgaagccatcatc
caggcctgccgtcaggtacaggccggagccggagatgtatatctggccggtggcgtggaa
agtatcagcaccgcgccctggcgtatggaacgcccgcaaagcgccgatgcccaaccccgt
ttcttcagccgtgcccgttttgcccctgacagcatcggtgatccggacatgggtgtggct
gccgaaaatgtcgctcgtcactgtggtgtcacgcgagaccgacaggatgcgcttgccctg
caaagtcatcagcgtgctgtcgctgcccagcaacaaggtctctttgctggggagctggtt
gccatcaatacatcgtcaggtgttattaataccgatgaaggcccacgagcgagcctttcc
aaggcactgctggcgcgcatgaaaccagtattcgacagcaccgggaccgtgactgccgga
aactgttgccaacataacgatggcgcggcgctggtgctcgtggtcagcgccaagagagcc
caaaaaatggggttgcccgtagccatgaagttctgtgatgccactgccgcaggtgttgac
ccaaacctgctcgggctcgggccggtgcctgctacccgcaagctgctgcgtagaaatccg
catatctctctgcccgagatcgacctgattgaattcaacgaagcctttgccgcacaagta
ctgggtgccctctacagccttggcattcccgctgaaaaaatcaatcgggagggtggcgct
attgccctgggtcacccttatggtgcttccggggcggtactcgtgacccggctattcagc
cagatgcaacgcaacgacagccccggtcaacatggtctggccaccctcggcatcggcggc
ggacttggattgagcgcattgtttgaatacaccagcctggacatacatgcgtga

DBGET integrated database retrieval system