KEGG   Gynuella sunshinyii: YC6258_02336Help
Entry
YC6258_02336      CDS       T03690                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
gsn  Gynuella sunshinyii
Pathway
gsn00230  Purine metabolism
gsn00250  Alanine, aspartate and glutamate metabolism
gsn01100  Metabolic pathways
Module
gsn_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:gsn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YC6258_02336
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YC6258_02336
Enzymes [BR:gsn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     YC6258_02336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt Pil1
Motif
Other DBs
NCBI-ProteinID: AJQ94374
UniProt: A0A0C5VVB4
Position
complement(2379996..2381288)
Genome map
AA seq 430 aa AA seqDB search
MAKNVVVLGTQWGDEGKGKVVDLLTDQANAVVRFQGGHNAGHTLVIDGVKTALHLIPSGI
LRDNVQCIIGNGVVLAPDALLNEMSKLEERGVPVRERLKISESCPLILPIHCALDQARET
KRGKAKIGTTGRGIGPAYEDKVSRRGLRMGDIYLPEFPEKLKELIEYHNFALTQYYGQEA
VSYDETLEQLYSWGEQLKDMVTDTVSLIHELREAGSNIMFEGAQGSMLDIDHGTYPYVTS
SNTTAGGVATGSGLGPMYIDYIIGITKAYTTRVGSGPFPTELFDKVGEHLSKQGNEFGTT
TGRARRCGWFDAALVKHSIRINSITGICLTKLDVLDGLETIKVCIGYEDQEGKRVSWPGT
AEKFEHIKPVYEELPGWKESTFGAKTMDELPANAQAYVRYLEQAIGCPIDIISTGPDRVE
TIVLRHSFTI
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaacgtagttgttttaggcacccaatggggtgacgaaggaaaaggcaaagtc
gtagatcttctgacagaccaggccaatgcggtcgttcggttccagggcggccacaacgcc
ggacatacactggttattgatggcgtaaaaacggcactacatcttattccatcgggcatt
ctcagagacaacgtccaatgcatcataggtaacggtgttgtgctggcacccgatgctctg
ttgaacgaaatgagcaagctggaagaacgcggcgtgccagttcgggaaaggctgaaaatt
tccgagtcctgcccattgattctgccgattcactgtgctctggaccaagcccgtgagacc
aaacgaggcaaagccaaaatcggtaccaccggtcgtggtatcggtccggcatatgaagac
aaagtatctcgtcgtggactgcggatgggcgatatatacctgccggaattcccggaaaag
ctgaaagaactgattgagtatcataactttgccctgactcagtactatggccaggaagct
gtcagttatgatgaaaccctggagcagttatatagctggggtgagcaactcaaagacatg
gtaacggatactgtcagtctgattcacgaactgcgtgaagcgggttcaaacattatgttt
gaaggtgcccagggttccatgctcgatatcgaccacggcacttatccctatgtgacctcc
tccaacaccactgcaggtggagttgctacaggttccgggttgggtccgatgtatatcgac
tacattattggcattaccaaagcctatacgactcgcgtgggttcaggcccctttccgaca
gaactgtttgataaagttggcgaacacctctccaaacagggtaatgagttcggcaccaca
acaggccgggcccgtcgttgcggctggtttgatgccgccctggttaaacacagcattcgg
atcaactcgatcaccggaatctgtctgaccaaactcgatgtgctggatggactggaaacc
attaaagtctgcattggctatgaagaccaggaaggcaagcgggtcagttggccaggcact
gcagaaaagtttgaacacatcaaaccagtctacgaagagttgcctggttggaaagaatcc
accttcggtgccaaaaccatggatgaacttcctgctaacgctcaggcttatgttcgttat
ctggaacaagctattggctgtccgatcgatatcatttccacgggccctgacagagtggaa
actattgttctgagacacagcttcaccatctga

DBGET integrated database retrieval system