KEGG   Gynuella sunshinyii: YC6258_04721Help
Entry
YC6258_04721      CDS       T03690                                 

Definition
(GenBank) methylase involved in ubiquinone/menaquinone biosynthesis
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
gsn  Gynuella sunshinyii
Brite
KEGG Orthology (KO) [BR:gsn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:gsn03009]
    YC6258_04721
Enzymes [BR:gsn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     YC6258_04721
Ribosome biogenesis [BR:gsn03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    YC6258_04721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_12 Methyltransf_32 MetW Methyltransf_23 Ubie_methyltran Mur_ligase_C FtsJ MTS Rad50_zn_hook AdoMet_MTase
Motif
Other DBs
NCBI-ProteinID: AJQ96753
UniProt: A0A0C5VU03
Position
5070967..5071806
Genome map
AA seq 279 aa AA seqDB search
MDKTQPVLKCPVCSQPLDNTDFGLACAAPHTFDRAKQGYVNLLMSNHKRSRSPGDDKEMV
TARTRFLDLQRYQPLIEAVIHCADKFWPDVQSWVDLGCGEGWYTQRLNEHLDFAKAFGLD
ISKHAVMAACKRSRQIDWYVASSARTPFMDQSMDAALILFAQLEPQELIRILKPEGSLII
AGAGSDHLLPLRELLYEQVNFNHFDPSTQLAPQFELAYDKEIKFEWIPENDQELYDLLAM
TPHNWRVKPEKKEAITELTGKLMTGHFRVQVWELVSSAG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggataaaacacaacccgttttaaaatgcccggtctgctcacaaccactggacaacact
gatttcggactggcgtgtgccgcccctcatacttttgacagagccaagcaaggctacgtc
aatctgttgatgtccaaccacaagcgttcccgctcaccgggtgatgacaaggaaatggtt
accgccagaacacgatttctggatcttcaacgctatcaacctttaattgaagctgtcatt
cactgtgccgataaattctggcccgacgttcaaagctgggtcgaccttggctgtggagaa
ggctggtacacacagcgattgaatgaacaccttgatttcgccaaagcatttggactcgat
atttccaaacatgcggtgatggctgcttgtaaacgcagcaggcaaatcgactggtatgtc
gccagtagcgcccgaaccccctttatggatcagtccatggatgccgcactgattttgttt
gcacaactcgaacctcaggaactgatacgaatactaaaaccggaaggcagtctgataatc
gccggagcgggttctgatcatttgcttccacttagagaactgttgtacgaacaggtcaat
ttcaaccattttgatccatccacgcagttagctccgcaattcgaacttgcctacgacaag
gaaattaagtttgagtggatacccgaaaatgatcaggaactgtatgacctgctggccatg
actccccacaactggcgggtgaaaccggaaaaaaaagaagcgattacagaattaacgggt
aaattgatgaccgggcactttcgggtacaggtatgggaactcgtctccagcgctggctag

DBGET integrated database retrieval system