KEGG   Gynuella sunshinyii: YC6258_04834Help
Entry
YC6258_04834      CDS       T03690                                 

Definition
(GenBank) 3-polyprenyl-4-hydroxybenzoate decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
gsn  Gynuella sunshinyii
Pathway
gsn00130  Ubiquinone and other terpenoid-quinone biosynthesis
gsn00627  Aminobenzoate degradation
gsn01100  Metabolic pathways
gsn01110  Biosynthesis of secondary metabolites
gsn01120  Microbial metabolism in diverse environments
gsn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gsn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    YC6258_04834
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    YC6258_04834
Enzymes [BR:gsn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     YC6258_04834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AJQ96866
UniProt: A0A0C5VRJ9
Position
complement(5180877..5181515)
Genome map
AA seq 212 aa AA seqDB search
MVDSDTITVAITGASGAQYGLRLVEQLVQADRRIYVLISKAAQMVMALEMDLSMPSNAVK
AEELLMQMTGATKNQINVFGREDWTSPVASGSGAPRQMVVCPCSTGTLSAVAAGACNNLI
ERAADVVLKERGQLIMVPRETPLSTIHLQNMLTLSQMGVVILPAMPGFYQRPESVDDMVD
FIVARILNQLGIKQQLLKPWGDSTPQSPIADT
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggttgattccgatactatcactgttgccattaccggtgcttcaggtgctcaatatggc
ctgcggctggtcgaacaattggtgcaggcggacaggcggatttatgtgttgatcagtaaa
gcggcgcagatggtgatggcattggagatggacctgtctatgccttccaatgctgtcaaa
gccgaagagttgcttatgcaaatgacaggtgcgacaaaaaatcagatcaacgtattcggc
cgggaggactggaccagcccggttgcttccgggtccggagcaccaagacagatggtggtg
tgcccatgctctactggtactttgtctgccgtagccgctggcgcctgcaacaatctgatt
gaacgtgcagcggatgtggttcttaaggaacgggggcagttgatcatggttccacgggag
accccgttatcaacgatacatttgcagaatatgttgacgttgagtcagatgggggtggtg
atactgccggcaatgcctggtttttaccagcgtccggagagtgttgatgatatggtcgat
tttatcgtcgcccgcattctgaatcagcttggtatcaaacagcagttgctcaaaccctgg
ggggattccacacctcagtcacccattgctgatacttga

DBGET integrated database retrieval system