KEGG   Gynuella sunshinyii: YC6258_05153Help
Entry
YC6258_05153      CDS       T03690                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
gsn  Gynuella sunshinyii
Pathway
gsn00564  Glycerophospholipid metabolism
gsn01100  Metabolic pathways
gsn01110  Biosynthesis of secondary metabolites
Module
gsn_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:gsn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    YC6258_05153
Enzymes [BR:gsn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     YC6258_05153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase DUF3182
Motif
Other DBs
NCBI-ProteinID: AJQ97183
UniProt: A0A0C5VV59
Position
5558166..5559068
Genome map
AA seq 300 aa AA seqDB search
MSLSLVQYVNRETSKQETERVYGEQELMFLYHNRLGKLIRKYLIRKPWFSHLNAIPKKVW
FSRKRIPHFAETFGVDILEAEKPLDQYQSLDEFFSRRLKPTARPLCQDPLALISPADGRV
LAYPIDQHAVMQIKQQPVAVAELLQSNEMAAELSGGTAVVVRLAPKDYHRFHFPCDGQLI
QAQAQPGPLESVHPIALNGGARSFQNKRVISVLQSITFGTLVMVEIGALTIGTIEQTYSG
NQFHRGQEKGYFRFGGSTVVLLWGANGPVIDQDILRNSRNGMETLVKFGTRIATASHLRS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtccctctcacttgtgcaatatgttaaccgggaaacgtccaaacaggagacggaacgg
gtttatggtgaacaggaactgatgtttctgtatcacaacagacttggcaaactgatacgt
aaatatctgatccgcaaaccatggttcagccatttgaatgccatccccaaaaaagtctgg
ttcagccgcaaacggattccgcatttcgcggagacgttcggggttgatattctggaagcg
gaaaagcctctcgatcagtatcaatcccttgatgagttttttagccggcggttgaagcca
acagcacggccactctgccaagatccattggcactgatttcacctgccgatggacgggtg
ctggcatatcccatcgatcaacacgccgttatgcagatcaagcagcaaccggttgcggtg
gcagaactattgcaatcgaacgaaatggcagcagaactttccggcggaacagccgtggtg
gtgcgactggccccaaaggattatcaccggtttcactttccttgtgacgggcaactcata
caggcacaggcccagccgggtccgctggagtccgttcacccaattgcactgaacggcggt
gcccggagttttcaaaataaacgggtcatcagtgttcttcagtccataacgttcggcaca
ctggtcatggttgagatcggcgctctgaccatcggcacgattgaacagacatattccggc
aatcaatttcatcgtggtcaggaaaagggctacttccgttttggcggttctacggtggta
ttactgtggggcgctaacgggccggtgattgatcaggatattctgcgcaactccagaaat
ggcatggaaaccctggtcaaattcggcactcgaattgccactgcatcacatttgcgttcc
tga

DBGET integrated database retrieval system