KEGG   Gynuella sunshinyii: YC6258_05577Help
Entry
YC6258_05577      CDS       T03690                                 

Definition
(GenBank) GTPase - translation elongation factor
  KO
K02358  elongation factor Tu
Organism
gsn  Gynuella sunshinyii
Brite
KEGG Orthology (KO) [BR:gsn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:gsn03012]
    YC6258_05577
   03029 Mitochondrial biogenesis [BR:gsn03029]
    YC6258_05577
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gsn04147]
    YC6258_05577
Translation factors [BR:gsn03012]
 Eukaryotic Type
  Elongation factors
   YC6258_05577
 Prokaryotic Type
   YC6258_05577
Mitochondrial biogenesis [BR:gsn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    YC6258_05577
Exosome [BR:gsn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YC6258_05577
  Exosomal proteins of breast cancer cells
   YC6258_05577
  Exosomal proteins of colorectal cancer cells
   YC6258_05577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AJQ97605
UniProt: A0A0C5VE73
Position
complement(6047311..6048504)
Genome map
AA seq 397 aa AA seqDB search
MSKATFERKKPHVNVGTIGHVDHGKTTLTAALTRVCADVWGGTAVAFDGIDNAPEERERG
ITISTAHVEYDSPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDEELLELVEMEVRELLSQYDFPGDDTPIVIGSALMALE
GKDDNEMGTSAVKKLVETLDEYIPEPERAIDLPFLMPIEDVFSISGRGTVVTGRVERGII
KVGEEVEIVGVRDTTKTTVTGVEMFRKLLDEGRAGENVGVLLRGTKRDDVERGQVLAKPG
TITPHTKFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGAVELPEGVEMVMPGDNI
KMVVTLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaggcaacctttgagcgtaaaaagccccacgtcaacgtgggtacaattggtcac
gttgaccatggtaaaaccacgctgacagcggccctgacgcgcgtatgtgcggatgtatgg
ggtggcacggcggtggcatttgatggtatcgacaatgcgccagaagagcgtgagcgtggt
atcacgatttcgactgcccacgtagagtatgactcaccaaaccgtcactacgcccacgtg
gactgcccaggacacgctgactacgttaagaatatgattactggtgcggcacagatggat
ggtgcgattctggtgtgttcagcagcagatggcccgatgcctcaaactcgagagcacatt
ttgttgtcccgtcaggtgggtgttccttacatcgtagtgttcctgaacaaggctgacatg
gttgatgatgaagagttgttggaactggtggagatggaagtgcgtgagctgttgtctcag
tacgatttcccaggtgacgataccccgatcgttattggttcagcgttgatggcgctggaa
ggtaaagatgataacgagatgggcacttcagcggttaagaagttggttgaaactctggat
gaatacattccagaaccagaacgtgcgattgacctgccgttcctgatgccaatcgaagac
gtattctcaatttctggccgtggtactgtggtgactggacgtgtagagcgcggcattatc
aaagttggtgaagaagttgagattgtaggtgttcgtgacaccactaaaacaaccgttacc
ggtgttgagatgttccgtaagctgctggacgaaggtcgtgcaggtgagaacgtgggtgtc
ttgttgcgtggtaccaagcgtgacgacgtagagcgtggtcaggtattggcgaagccaggt
acgattactccgcacactaaattcgaatcagaagtatatgttctgtcgaaagaagaaggt
ggtcgtcatactccgttcttcaaaggttatcgtcctcagttctacttccgtacaacggac
gtaacgggtgcggtagagttgccagaaggcgtagaaatggttatgcctggtgacaacatt
aagatggttgtaacgttgattgctccgattgcaatggatgatggtctacgtttcgcgatt
cgtgaaggcggccgtacagtgggtgccggtgttgttgctaaagtaatcgagtaa

DBGET integrated database retrieval system