KEGG   Geobacillus subterraneus: GS3922_06765Help
Entry
GS3922_06765      CDS       T04323                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gsr  Geobacillus subterraneus
Pathway
gsr00071  Fatty acid degradation
gsr00072  Synthesis and degradation of ketone bodies
gsr00280  Valine, leucine and isoleucine degradation
gsr00310  Lysine degradation
gsr00362  Benzoate degradation
gsr00380  Tryptophan metabolism
gsr00620  Pyruvate metabolism
gsr00630  Glyoxylate and dicarboxylate metabolism
gsr00640  Propanoate metabolism
gsr00650  Butanoate metabolism
gsr00900  Terpenoid backbone biosynthesis
gsr01100  Metabolic pathways
gsr01110  Biosynthesis of secondary metabolites
gsr01120  Microbial metabolism in diverse environments
gsr01130  Biosynthesis of antibiotics
gsr01200  Carbon metabolism
gsr01212  Fatty acid metabolism
gsr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gsr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GS3922_06765
   00630 Glyoxylate and dicarboxylate metabolism
    GS3922_06765
   00640 Propanoate metabolism
    GS3922_06765
   00650 Butanoate metabolism
    GS3922_06765
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GS3922_06765
   00072 Synthesis and degradation of ketone bodies
    GS3922_06765
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GS3922_06765
   00310 Lysine degradation
    GS3922_06765
   00380 Tryptophan metabolism
    GS3922_06765
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GS3922_06765
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GS3922_06765
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GS3922_06765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gsr04147]
    GS3922_06765
Enzymes [BR:gsr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GS3922_06765
Exosome [BR:gsr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GS3922_06765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: AMX83405
UniProt: A0A143MHC2
Position
1360159..1361334
Genome map
AA seq 391 aa AA seqDB search
MREVVITAAVRTPIGTFGGVFKDLLPTDLIVPVLEEAVKRSQIEKSEVNEVILGHCIQRT
DIPNTARTAALLAGFPHTTTGFTIQRQCASGMQAIISAAMQIEVGLSDVVIAGGVEAMSS
SPYIVKQYRWGARLQHQQVYDSVWEVLEDPIHHVMMGETAENLAEQYGITREEQDELALL
SHRRAILAMESGYFDSQIVPITVKTRKEEIVVTKDEHPRADVTKEKLASLKPVFRKNGTV
TAGNASGINDGAAALVLMSAEYAQQRGIQPLAKVVGYAVAGVDPLVMGRGPVPAVQKGLE
RVNWTLAEADLIEINEAFAAQYLAVERELRLDRDKVNVNGSGISLGHPIGCTGARIVVSL
IHELQRRQLEKGIASLCVGGGMGTAVFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagtggtcattacagcagccgtgcgcacaccgattggaacatttggcggcgtc
tttaaagacctgttgccaacagatttaattgttcctgttttagaggaagcagtaaagcgc
agccaaattgagaaaagcgaagtaaacgaagtgattttggggcattgcattcagaggacg
gatatacctaatacagcaagaacggctgccttgctagccggatttcctcatacaacaacc
ggttttacgattcagcgccagtgcgcttctggaatgcaagcgattatttcggcggctatg
caaattgaagtcgggctgagcgatgtggtcattgccggcggcgtggaagccatgagttct
agtccgtatatagtaaagcagtatcgttggggggcgcgtttacagcaccagcaagtctat
gatagcgtttgggaagttcttgaggaccccattcaccatgtgatgatgggggaaacggcc
gagaatcttgccgaacagtacgggatcacaagggaagagcaggatgagctggcgttgtta
agccatcgacgagctattttggcgatggaatcgggatactttgattctcaaattgttccg
atcacggtaaaaacacggaaggaagagatagttgtaacgaaagatgagcatccacgagcc
gatgtgacgaaagaaaaattggcttctttaaaacctgtatttcgaaaaaatggaacggta
acagcagggaatgcgtcgggaattaatgacggtgctgctgcgcttgtgctcatgtccgcc
gagtatgcgcagcaacgaggaatccagccgcttgcgaaagtagttggttatgctgttgcc
ggagtggatcctctagtgatgggacgcggtccggttccagcggtacaaaaaggattagaa
agggtaaattggacgttagcggaagccgatttaattgaaatcaatgaagcatttgctgct
cagtatttagctgtagaaagggaactgcgtttagatagagataaagtgaacgtaaacgga
agcggcatcagcttgggacatccgattggatgcacaggagcgcgtattgtcgtcagtctt
attcatgagttgcagcgccgtcagcttgaaaaaggaattgcctctttatgcgtgggcggt
ggaatgggaacggcggtgtttattgaggctttgtaa

DBGET integrated database retrieval system